KEGG   Pseudovibrio sp. FO-BEG1: PSE_3207Help
Entry
PSE_3207          CDS       T01669                                 

Gene name
exoN
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PSE_3207 (exoN)
   00052 Galactose metabolism
    PSE_3207 (exoN)
   00500 Starch and sucrose metabolism
    PSE_3207 (exoN)
   00520 Amino sugar and nucleotide sugar metabolism
    PSE_3207 (exoN)
Enzymes [BR:psf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PSE_3207 (exoN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3440414..3441298
Genome map
AA seq 294 aa AA seqDB search
MTLAIRKAVLPVAGLGTRFLPATKAVPKEMLTILDRPIIQYVVDEARAAGIEHIVFVTGR
NKQVIEDHFDIAYELEETLRRRNKEHALELLEKIRPSAGTTSFTRQQEPLGLGHAIWCAR
DIIGHEPFAILLPDMLMKAPKGCLSQMVEAYENHGGNIISVEEVPWDQTHKYGIIERDAP
RTDETFAITGMVEKPEPGTAPSNLYINGRYILQPEIFGLLENQSTGAGGEIQLTDAMLTL
MGQQDFHGVEFRGETYDCGSRSGFLSANVAYALDDSELAAQLRPMLDKLLVKTS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacacttgcaatacgaaaagctgttctcccggttgcaggtctgggcacccgcttccta
cctgcgacaaaagccgttccaaaagagatgctcactattttggatcgtcccatcatccaa
tacgtggttgacgaagcacgggctgctgggatcgagcacatcgtatttgtaactggccgc
aacaagcaggtaatcgaagatcacttcgacattgcttatgagctggaagaaacgctgcgc
cgcagaaacaaagaacacgcgctggagctgcttgaaaaaatccgcccttccgcaggtacg
acaagcttcacccgtcagcaggagccgctgggccttggtcacgcaatctggtgtgctcgc
gacatcatcggtcacgaaccattcgcaattttgctacctgacatgctaatgaaagcgcca
aaaggctgtctctctcagatggttgaagcctatgaaaaccacggcggcaacatcatttct
gttgaggaagtaccgtgggatcagacccataagtacggcattattgaacgtgacgctcct
cgcacggatgaaacattcgccattacaggcatggtcgagaagccagagccaggcacggca
ccttctaatctttacatcaatggccgttatatccttcagccggagatctttggcctgctg
gaaaaccagagcacgggtgctggtggagaaattcagctcacagatgcaatgctcaccctc
atggggcagcaggacttccacggcgttgaattccgtggagaaacttacgactgtggttct
cgctcagggttcttgtccgcaaatgtcgcttacgcattggatgattcggagcttgcagct
cagctgcgtccgatgctggacaaactacttgtaaaaaccagctga

DBGET integrated database retrieval system