KEGG   Pseudovibrio sp. FO-BEG1: PSE_3207Help
Entry
PSE_3207          CDS       T01669                                 

Gene name
exoN
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
psf00040  Pentose and glucuronate interconversions
psf00052  Galactose metabolism
psf00500  Starch and sucrose metabolism
psf00520  Amino sugar and nucleotide sugar metabolism
psf01100  Metabolic pathways
psf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PSE_3207 (exoN)
   00052 Galactose metabolism
    PSE_3207 (exoN)
   00500 Starch and sucrose metabolism
    PSE_3207 (exoN)
   00520 Amino sugar and nucleotide sugar metabolism
    PSE_3207 (exoN)
Enzymes [BR:psf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PSE_3207 (exoN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AEV37715
UniProt: G8PH31
Position
3440414..3441298
Genome map
AA seq 294 aa AA seqDB search
MTLAIRKAVLPVAGLGTRFLPATKAVPKEMLTILDRPIIQYVVDEARAAGIEHIVFVTGR
NKQVIEDHFDIAYELEETLRRRNKEHALELLEKIRPSAGTTSFTRQQEPLGLGHAIWCAR
DIIGHEPFAILLPDMLMKAPKGCLSQMVEAYENHGGNIISVEEVPWDQTHKYGIIERDAP
RTDETFAITGMVEKPEPGTAPSNLYINGRYILQPEIFGLLENQSTGAGGEIQLTDAMLTL
MGQQDFHGVEFRGETYDCGSRSGFLSANVAYALDDSELAAQLRPMLDKLLVKTS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacacttgcaatacgaaaagctgttctcccggttgcaggtctgggcacccgcttccta
cctgcgacaaaagccgttccaaaagagatgctcactattttggatcgtcccatcatccaa
tacgtggttgacgaagcacgggctgctgggatcgagcacatcgtatttgtaactggccgc
aacaagcaggtaatcgaagatcacttcgacattgcttatgagctggaagaaacgctgcgc
cgcagaaacaaagaacacgcgctggagctgcttgaaaaaatccgcccttccgcaggtacg
acaagcttcacccgtcagcaggagccgctgggccttggtcacgcaatctggtgtgctcgc
gacatcatcggtcacgaaccattcgcaattttgctacctgacatgctaatgaaagcgcca
aaaggctgtctctctcagatggttgaagcctatgaaaaccacggcggcaacatcatttct
gttgaggaagtaccgtgggatcagacccataagtacggcattattgaacgtgacgctcct
cgcacggatgaaacattcgccattacaggcatggtcgagaagccagagccaggcacggca
ccttctaatctttacatcaatggccgttatatccttcagccggagatctttggcctgctg
gaaaaccagagcacgggtgctggtggagaaattcagctcacagatgcaatgctcaccctc
atggggcagcaggacttccacggcgttgaattccgtggagaaacttacgactgtggttct
cgctcagggttcttgtccgcaaatgtcgcttacgcattggatgattcggagcttgcagct
cagctgcgtccgatgctggacaaactacttgtaaaaaccagctga

DBGET integrated database retrieval system