KEGG   Pseudovibrio sp. FO-BEG1: PSE_3244Help
Entry
PSE_3244          CDS       T01669                                 

Gene name
nagZ
Definition
Beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PSE_3244 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    PSE_3244 (nagZ)
Enzymes [BR:psf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PSE_3244 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3478963..3479991)
Genome map
AA seq 342 aa AA seqDB search
MFLKSFISGCLGPELSAEDKAFFRDQQPVGLILFARNMETPEQIRRLCADFREAVGRADA
PVFIDQEGGRVQRFGAPHVPIYPAAGTLGQLYGQDPEAAKRAAYLHALLIGLDLRDLGLT
GNCIPCLDMPIEGASNIIGLRAYGSDVRLVSDMGRAAMDGCLAAGVMPVMKHMPGHGRAL
VDTHLALPEVDVSFAELEARDFMPFKLLNDCPMGMTAHIVFKEIDGDHPVTQSSYAIQRV
IRETIGFDGVLMSDDISMKALGGELKERVEKIVAAGCDLVLHCNGELDEMKVVASAVPEV
DGKRVERLEAAMQRNTQVFDGDVHALRAEFDELTAKAKGIDA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtttttaaaatcgttcatttccggatgccttggacctgagcttagtgctgaggacaaa
gccttttttcgtgatcagcaacctgttggtctgatcctttttgcacgcaacatggaaacg
cctgagcagatccgtcgtctttgcgcggattttcgtgaggctgtcgggcgtgcagatgcg
cctgttttcattgatcaggaaggtggccgtgtgcagcgctttggcgcgccgcatgtgcca
atctacccggctgccggaacgcttgggcaactttacgggcaggatccggaagcggcaaag
cgggcggcgtacttgcacgcgctgttgatcgggcttgatctgcgcgatcttgggctgact
ggcaactgtattccgtgccttgatatgccgattgagggtgctagcaacattatcggtttg
cgcgcctacggttccgatgtgcggttggtgagcgatatggggcgggcggctatggatggc
tgtctggcggctggtgtgatgccggtgatgaagcatatgccaggacatggacgtgcgctg
gttgatactcatcttgcgttgccggaagtggatgtcagttttgctgagcttgaggcaaga
gactttatgccgttcaagctcttgaatgattgccctatggggatgacagcccacatcgtc
tttaaagagattgatggagatcatcctgttacgcaatcttcctatgctattcagagggtt
atccgggaaacgatcggatttgacggcgttttgatgagtgatgatatctccatgaaagcc
cttggtggtgagctgaaggaacgggtggagaagattgttgccgctggctgtgatctagtt
ctgcattgcaatggcgagctggatgaaatgaaagttgttgcctctgctgtgccagaggtg
gatggcaagcgggtggagcgccttgaagcggccatgcagcgaaatacccaagtgtttgat
ggggatgtacatgcgctgcgggcggagtttgatgagctaaccgcaaaagccaaagggatt
gatgcttga

DBGET integrated database retrieval system