KEGG   Pseudovibrio sp. FO-BEG1: PSE_3383Help
Entry
PSE_3383          CDS       T01669                                 

Gene name
tpiA
Definition
triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSE_3383 (tpiA)
   01230 Biosynthesis of amino acids
    PSE_3383 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSE_3383 (tpiA)
   00051 Fructose and mannose metabolism
    PSE_3383 (tpiA)
   00562 Inositol phosphate metabolism
    PSE_3383 (tpiA)
Enzymes [BR:psf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PSE_3383 (tpiA)
Exosome [BR:psf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PSE_3383 (tpiA)
  Exosomal proteins of bladder cancer cells
   PSE_3383 (tpiA)
  Exosomal proteins of melanoma cells
   PSE_3383 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3680275..3681024)
Genome map
AA seq 249 aa AA seqDB search
MTNRPLVAGNWKMNGTKASAAELEAMGAGYDSALAEKVELLICPPALLVAQLASQDKIAI
GAQNCHAKESGAHTGDISAEMIRDAGGKFVIVGHSERREDHGESDADVCEKAEAAYRAGL
VAIVCVGEVESERRAGTTLDVVTKQVLGSVPAGATAENTVIAYEPVWAIGTGLTPTPADV
AEVHASIRATLIKQFGDEIGGKMRVLYGGSVKPTNAKELLAVENVDGALVGGASLKAADF
LGIAEAYRG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgactaatcggccacttgttgctggtaactggaaaatgaatggcaccaaagcttctgct
gcagagctggaagctatgggtgcgggatacgactcagcacttgccgaaaaagtagagctt
ctgatttgccctcctgcattgctggttgcacagcttgcttctcaggacaaaatcgcgatt
ggcgcccagaactgccacgctaaagaaagcggtgcgcatactggcgacatctccgctgag
atgatccgtgatgctggcggcaagtttgttattgttggtcactccgagcgccgtgaagac
catggcgaatctgacgcggatgtttgcgagaaggctgaagctgcttatcgcgctggtctg
gttgcgatcgtttgtgttggtgaagttgagagtgagcgccgcgctggcactactcttgat
gttgttaccaaacaggttcttggttctgtgccagcaggcgcaaccgctgagaataccgtg
atcgcttatgagccagtctgggcaatcggtaccggcctgacgccaacacctgctgatgtg
gctgaagttcatgcgtccatccgcgcaacgctgatcaagcagtttggcgatgagattggt
ggcaaaatgcgcgtcctttatggtggctctgttaagcctaccaacgcaaaagaactgctt
gcggttgaaaacgttgacggtgcactggttggcggtgcaagcctgaaagcggcggatttc
cttggaatcgctgaggcttatcgcggctaa

DBGET integrated database retrieval system