KEGG   Pseudovibrio sp. FO-BEG1: PSE_3383Help
Entry
PSE_3383          CDS       T01669                                 

Gene name
tpiA
Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
psf00010  Glycolysis / Gluconeogenesis
psf00051  Fructose and mannose metabolism
psf00562  Inositol phosphate metabolism
psf01100  Metabolic pathways
psf01110  Biosynthesis of secondary metabolites
psf01120  Microbial metabolism in diverse environments
psf01130  Biosynthesis of antibiotics
psf01200  Carbon metabolism
psf01230  Biosynthesis of amino acids
Module
psf_M00002  Glycolysis, core module involving three-carbon compounds
psf_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSE_3383 (tpiA)
   00051 Fructose and mannose metabolism
    PSE_3383 (tpiA)
   00562 Inositol phosphate metabolism
    PSE_3383 (tpiA)
Enzymes [BR:psf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PSE_3383 (tpiA)
Exosome [BR:psf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PSE_3383 (tpiA)
  Exosomal proteins of bladder cancer cells
   PSE_3383 (tpiA)
  Exosomal proteins of melanoma cells
   PSE_3383 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM PGA2
Motif
Other DBs
NCBI-ProteinID: AEV37889
UniProt: G8PIZ0
Position
complement(3680275..3681024)
Genome map
AA seq 249 aa AA seqDB search
MTNRPLVAGNWKMNGTKASAAELEAMGAGYDSALAEKVELLICPPALLVAQLASQDKIAI
GAQNCHAKESGAHTGDISAEMIRDAGGKFVIVGHSERREDHGESDADVCEKAEAAYRAGL
VAIVCVGEVESERRAGTTLDVVTKQVLGSVPAGATAENTVIAYEPVWAIGTGLTPTPADV
AEVHASIRATLIKQFGDEIGGKMRVLYGGSVKPTNAKELLAVENVDGALVGGASLKAADF
LGIAEAYRG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgactaatcggccacttgttgctggtaactggaaaatgaatggcaccaaagcttctgct
gcagagctggaagctatgggtgcgggatacgactcagcacttgccgaaaaagtagagctt
ctgatttgccctcctgcattgctggttgcacagcttgcttctcaggacaaaatcgcgatt
ggcgcccagaactgccacgctaaagaaagcggtgcgcatactggcgacatctccgctgag
atgatccgtgatgctggcggcaagtttgttattgttggtcactccgagcgccgtgaagac
catggcgaatctgacgcggatgtttgcgagaaggctgaagctgcttatcgcgctggtctg
gttgcgatcgtttgtgttggtgaagttgagagtgagcgccgcgctggcactactcttgat
gttgttaccaaacaggttcttggttctgtgccagcaggcgcaaccgctgagaataccgtg
atcgcttatgagccagtctgggcaatcggtaccggcctgacgccaacacctgctgatgtg
gctgaagttcatgcgtccatccgcgcaacgctgatcaagcagtttggcgatgagattggt
ggcaaaatgcgcgtcctttatggtggctctgttaagcctaccaacgcaaaagaactgctt
gcggttgaaaacgttgacggtgcactggttggcggtgcaagcctgaaagcggcggatttc
cttggaatcgctgaggcttatcgcggctaa

DBGET integrated database retrieval system