KEGG   Pseudovibrio sp. FO-BEG1: PSE_3386Help
Entry
PSE_3386          CDS       T01669                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:psf01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:psf00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3684353..3685144
Genome map
AA seq 263 aa AA seqDB search
MSDILKKIEAYKREEIAAAKAQTSLADLDAAIKAATPTRGFANALKAKHANGECALIAEV
KKASPSKGLIRADFNPPVLAKAYENGGAACLSVLTDTPSFQGKPEYLVAARNEVSLPVLR
KDFLYDTYQVHEARAWGADCILIIMAAVDDALAKELEDTAFELGMDALIEVHDEAELERA
LKLTSPLVGINNRNLKTFETSLETSERLAPLIPQDRIIVGESGLFTPEDLSRMEKSGIST
FLIGESLMRQDDVENATKALLKR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatatccttaagaaaatcgaagcttacaagcgtgaagagattgccgctgcaaaa
gcgcaaacttctctggctgatctggatgcggcaatcaaggcagcaactccaacccgcggc
ttcgcaaacgcactgaaagcaaagcacgcaaacggtgagtgcgccctgattgctgaggta
aaaaaggccagcccgtccaaaggcctgatccgcgcagacttcaatccaccagtacttgca
aaagcttatgagaacggcggcgcagcctgtttgtccgtgctgaccgacacgccgtccttc
cagggcaagccagaatacctcgtcgcagcccgcaatgaagtctccttgccagttctgcgc
aaagactttctttatgacacctatcaggtgcatgaagcccgcgcctggggcgcagactgc
atcctgatcatcatggcagccgttgatgatgcattagccaaagagctggaagacaccgcc
tttgagcttggcatggatgcactgattgaggtgcacgatgaggctgagctggagcgcgca
ctgaagctcacctcaccactcgtcggcatcaataaccgcaacctgaaaacattcgagaca
tcactggagaccagtgaacgccttgctccattgatcccgcaagaccggatcatcgtcggc
gaaagcggcctgttcactccggaagatctttcccgcatggaaaaatccggcatctccacc
ttcctcatcggtgaaagcctgatgcggcaggacgatgtagaaaacgcaacaaaagcgctg
cttaaacgctaa

DBGET integrated database retrieval system