KEGG   Pseudovibrio sp. FO-BEG1: PSE_3597Help
Entry
PSE_3597          CDS       T01669                                 

Gene name
hemB
Definition
Delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PSE_3597 (hemB)
Enzymes [BR:psf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     PSE_3597 (hemB)
Exosome [BR:psf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSE_3597 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3909204..3910232
Genome map
AA seq 342 aa AA seqDB search
MPFANESHSSVDMNQILNGRRMRRNRHSDWSRRLIRENTITTDDLIWPIFLIDGEKKTEP
VASMPGVERYSVDMAVRAAEQAAELGIPVIALFPNTDPDLRDEMGTEALNDSNLTCRALQ
AIKAEGFPVGLMTDVALDPYTSHGHDGLMAGDKIINDETVDQLCRQALIQAEAGSDIIAP
SDMMDGRIGAIRYALDNQGFENLQIMAYSAKYASAFYGPFRDAVGSNANLKGDKRTYQMD
PANTDEALKEAELDLAEGADMIMVKPGMPYLDILRRIKDTFLAPTYAYQVSGEYAMICAA
AQNGWMDKDKAMMESLMAFKRAGADGVLTYFAPELAKKLNGK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttgccaatgaatcgcattcttccgtagacatgaaccagattttgaacggccgc
cgaatgcgtcgcaatcgtcacagcgattggtcccgtcgcctcatccgcgaaaacacaatc
accactgacgacttgatctggccaatctttctgattgatggcgaaaagaaaacggaacca
gttgcttccatgccgggcgttgagcgctactctgtcgatatggctgtgcgcgccgctgag
caggcagcagaactgggcattccggttattgccctgttcccaaacacagatccagacctg
cgcgacgaaatgggcacagaagcgctgaatgacagcaacctcacctgccgcgcccttcag
gcgatcaaggcagaaggtttccctgttggcctgatgacggacgttgcacttgacccttac
acctctcacggccacgacggcttgatggcaggtgataagatcatcaacgacgaaaccgtt
gatcagctctgccgtcaggcgcttattcaggcagaagcaggctctgacatcattgctcca
tccgacatgatggatggtcgcatcggcgcaatccgttatgcgctggacaatcagggcttc
gaaaatctgcagatcatggcgtactctgctaagtacgcttccgccttttacggcccgttc
cgtgatgctgttggctccaatgcaaatctgaagggcgacaagcgtacctatcagatggac
ccggccaacactgacgaagcactgaaagaagccgagctggatctggcagaaggcgcggac
atgatcatggtgaagcccggcatgccgtatctcgacattctccgccgcatcaaagatacc
ttccttgcaccaacctacgcctatcaggtctctggtgagtacgcgatgatctgcgcggca
gctcaaaacggctggatggacaaggacaaggcgatgatggaaagcctgatggccttcaaa
cgcgccggtgcagatggcgtcttaacctactttgcacctgaacttgcgaaaaaactgaac
ggcaaataa

DBGET integrated database retrieval system