KEGG   Pseudovibrio sp. FO-BEG1: PSE_3657Help
Entry
PSE_3657          CDS       T01669                                 

Gene name
speB
Definition
Agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:psf00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3977467..3978444
Genome map
AA seq 325 aa AA seqDB search
MSDVKHPSSLDEYSHGDLAYTRSTPYGTIAESSYAGALSFMRRKFTKDLTGVDVAVLGIP
FDTSVSNRPGCRFGPRAIRQASSILAWDHAWGWSFDPFDRLAVVDYGDFIFDPGYPMSVP
EDLERQAAKVLQANVATLMLGGDHFSTYPMLKTHAQKHGPLSLIQFDAHSDTWTDNSTRI
DHGTMFYRAVKDGLINPETSIQVGIRTNNEDTQGLTTITADWVRNNGAQATIDRILTVIG
QSACYISFDIDCLDPAFAPGTGTPVVGGMNTGETREILRGLAGINLKGMDLVEVAPAYDH
AEITALAGATLALDLLCIYASQTTR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgatgtaaaacacccatcctcgctagatgaatactcgcatggagatctggcctac
acccgctccacgccctacggcacaatagctgaatccagctatgccggtgcgctcagcttc
atgcgccgcaagttcacgaaagacctgactggcgttgatgtcgccgttctgggcattccg
ttcgacacctctgtcagcaacagaccgggctgccggtttggtccacgcgccatcaggcaa
gcctcctccattctggcatgggatcatgcatggggctggtcattcgacccgttcgaccgc
cttgccgttgtcgattacggcgatttcatcttcgaccccggctatccaatgagcgtaccg
gaggatctggaacgtcaggccgccaaagttctgcaagcaaatgtcgccacgctcatgcta
ggcggagaccatttcagcacgtaccccatgctcaagacacatgcccaaaagcacgggcct
ttgtctctcatccagtttgatgcccacagcgatacatggacggacaactccacccgcatc
gatcacggcaccatgttctacagggctgtgaaagacggcctgatcaatccggaaacatcg
atacaggttggtatcagaaccaacaatgaagacacgcagggcctcaccacaattacggcg
gactgggtgcgtaataacggggcgcaggccaccattgatcgcattcttacagtcatagga
caaagcgcctgctacatcagtttcgacatagactgcctcgacccagccttcgccccgggc
acaggcacaccagtcgttggcggcatgaacaccggggaaactcgcgagatcctgcgcggc
cttgctggaataaacctgaaaggcatggaccttgtggaagtggcccctgcctacgaccat
gctgaaatcacggcccttgccggagccacattagcgctggacttgctatgcatctacgcc
agccagaccaccagataa

DBGET integrated database retrieval system