KEGG   Pseudovibrio sp. FO-BEG1: PSE_3779Help
Entry
PSE_3779          CDS       T01669                                 

Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PSE_3779
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSE_3779
Enzymes [BR:psf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     PSE_3779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4118290..4119156
Genome map
AA seq 288 aa AA seqDB search
MDLADEAVEVSRQVEKQKAVLRGRTQINLFFEASTRTQSSFELAGKRLGADVMNMSVSTS
SVKKGETLIDTAATLNAMRPDLLVVRHHAAGAVHLLARKVGCAVVNAGDGPHEHPTQALL
DALTIRRHKGTLGGLTVAICGDIRHSRVARSNIILLSNMGARVRVIAPSTLLPSGIHSMG
VEVFTDMREGLKGCDIVMMLRLQRERMSGAFVPSVREYFRYHGLDAEKLSYAKPDALVMH
PGPMNRGVEISAEVADGPQSLIREQVEMGVAIRMAVLEALAQNLPDNV
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ttggaccttgccgacgaagccgtcgaagtctccagacaggtagaaaagcagaaagctgtt
ctgcgtgggcgaacgcaaatcaacctcttctttgaggcttccacccgcacccaatcttct
tttgagcttgcaggcaagcgtctgggcgcggatgtgatgaacatgtcggtctccacctca
tcggtgaagaaaggggaaaccctgatcgacacagctgcaaccctgaacgcaatgcgtcct
gacttgctggttgttcgccaccacgccgcaggtgcagttcacctgctggctcgcaaagtc
ggttgcgcggtcgtcaacgccggtgacggccctcacgaacacccaactcaggctctgctg
gatgccttgaccatccgccgccacaaaggaaccctcggtggtctgacagtagccatttgc
ggcgacatccgccattcccgcgtcgcgcgctccaacatcatccttctctccaatatggga
gcccgcgtgcgtgtcatagctccctctacactactgccctctggtattcatagtatgggc
gtagaagtattcacagacatgcgcgaaggacttaagggctgcgacatcgtcatgatgctg
cgtttgcaacgcgaacgtatgagcggcgcctttgtaccatctgttcgtgagtatttccgt
taccacggtctggacgcagaaaagctctcctatgcaaagcctgatgctctggtcatgcac
cccggtccaatgaaccgcggggtggagatctcagcagaagtcgcggatggcccgcaaagt
ctgatccgcgagcaagtggagatgggcgttgccattcgcatggcagtgcttgaagctctc
gctcaaaacctccctgacaacgtgtaa

DBGET integrated database retrieval system