KEGG   Pseudovibrio sp. FO-BEG1: PSE_3972Help
Entry
PSE_3972          CDS       T01669                                 

Gene name
folE
Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:psf00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4307072..4307704
Genome map
AA seq 210 aa AA seqDB search
MDAVLRPVTETDPTATEDNKLPNRPSRAEAEAAARVLLQWIGDDPEREGLLDTPKRVVKA
YEDLFSGYKEDPREHLERTFEEVGGYNDIVLLKDITFTSFCEHHVLPFTGKAHIAYYPNH
AVVGLSKIARVVEIYARRLQTQEHLTVQIATALEEYLAPRGVAVMIEAEHQCMSMRGIQK
QGVSTLTNRFSGVFEDNASEQVRFMTMVRS
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgttttgagaccggttacagaaaccgatcccacggctacagaagacaacaag
ctccccaaccgccctagccgggctgaagctgaggctgctgcgcgcgtacttcttcaatgg
atcggagatgatccggagcgcgaaggtttgctggatacaccaaagcgcgtggtcaaagcc
tacgaagatcttttctccggttacaaggaagatcctcgcgagcatctggaacgtaccttt
gaagaggtcggtggatacaacgatattgtgctgctgaaagatatcacttttacatctttc
tgtgagcatcacgtcctgccattcacaggcaaggcgcatatcgcctattatccaaaccat
gctgtcgtgggcctttccaagatcgcacgtgttgtagaaatctacgcacgtcgccttcag
acacaggaacatctgaccgttcagatcgcaactgcactggaagaatatctggctcctcgt
ggcgtcgccgtcatgatcgaagcagagcaccagtgcatgtccatgcgcggcattcaaaaa
cagggtgtctccacactcaccaaccggttctccggtgtttttgaagacaatgcctctgaa
caggtacgcttcatgacaatggtccgttcgtaa

DBGET integrated database retrieval system