KEGG   Pseudovibrio sp. FO-BEG1: PSE_4234Help
Entry
PSE_4234          CDS       T01669                                 

Gene name
folA
Definition
Dihydrofolate reductase type III DHFR
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:psf00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:psf00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4581956..4582477)
Genome map
AA seq 173 aa AA seqDB search
MKQISMISAVAENGVIGANNDMPWSVSTDLKFFRKTTTGKPVIMGRRTFESICTTLGKPL
PNRKNIVITRDPNYAYDGVEVVSSLGDALTLANDIAENDDVDEIMIVGGGQIYKEAMPKA
STLYITRIHAQPDGDTKFPEIHEDEWELVERTPFDRGEKDSADSSLEIYRRRL
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaatttcgatgatttcagctgttgctgaaaatggtgtgattggcgcaaacaat
gacatgccatggtctgtttctaccgatctgaaattctttcgcaagacgacgacaggcaag
ccggtgatcatggggcggcgtacgtttgagagcatttgcacgacgcttggcaaacctctg
ccaaaccgcaaaaacatcgtgattacgcgtgatccgaattacgcctatgacggtgttgaa
gtggtgagtagccttggggatgcgcttactctggccaatgatattgccgagaatgatgat
gtcgatgaaatcatgattgttggtggtgggcagatctataaagaagccatgccgaaggct
tcgacgctctacatcacgcgtatccatgctcagccagatggtgacaccaagtttcctgag
atccatgaggatgagtgggaacttgtggagcgcacgccgtttgatcgcggagaaaaagac
tctgcggattcctcactggaaatctaccgccgtcgcctctga

DBGET integrated database retrieval system