KEGG   Pseudovibrio sp. FO-BEG1: PSE_4273Help
Entry
PSE_4273          CDS       T01669                                 

Definition
cell cycle protein
Orthology
K03588  
cell division protein FtsW
Organism
psf  Pseudovibrio sp. FO-BEG1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4626354..4627511)
Genome map
AA seq 385 aa AA seqDB search
MVSRTDRSAFAEWLWTIDRYMLIGIFTLMVSGLVLSLAASPPVAERIGLESFYFVKKQAI
FLVPSAALMLGVSALSPRYVRRVALLVFCGMLVLLLGTLFFGTDIKGARRWVSLFGVSIQ
PSEFIKPALVVIVAFLLSEGRKAQDVPGQLISIILFGIVAAMLIAQPDFGQTMLLTIVLF
ALFFLNGLSWLAIVPLGVMGILGVAAGFTYLPHVRGRIMRFLDPASGDTYQIDKAIDSFI
AGGWLGRGVGEGTVKRILPDSHTDFIFAVAAEEYGIIVCVVLVTVFAFVVLRGLYMAMQD
QDPFGRLASSGLIVMFGLQSCINMAVNLNLMPSKGMTLPLISSGVSSLMAISLTMGFVLA
LTRKRPQPRKNPIITVTRAAPLQHA
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggtttcacgtacggatcgcagtgcgtttgcagaatggctttggacgatcgaccgctac
atgctgattggcatcttcacgctgatggtgtccggtctggtgttgtcacttgcggccagc
cctcctgttgctgagcgtatcgggcttgagagcttctactttgtgaagaagcaggccatc
ttccttgttccaagcgctgcattgatgctgggcgtttcggcactgtctccgcgctatgtg
cggcgggtggctttgctggtgttctgcggcatgcttgtgctgctgctggggacactgttc
ttcgggacggacattaaaggcgcacggcgctgggtgagcctgtttggtgtttccattcag
ccttccgagttcatcaagccagcgcttgttgtgatcgtggcgtttctgctttctgaagga
cgcaaggcgcaggatgtgccgggtcagctgatctccattattctgttcggtattgtggcg
gccatgctgattgcgcagcccgactttggtcagaccatgctgctgacgatcgtgctattt
gcgctgttcttcctgaacgggctgtcatggctggcgattgtgccgcttggcgtcatgggc
attcttggcgtggcggctggctttacgtatctgccgcacgtgcgcgggcgtatcatgcgc
ttccttgatcctgcttccggtgacacctaccaaattgataaagcaatcgactctttcatt
gcgggcggttggcttggtcgtggtgtgggtgaaggcaccgtgaagcgtattctgcctgat
agtcatacggactttatctttgctgttgcggcagaagaatacggcatcatcgtgtgtgtg
gtgcttgtgactgtgtttgcgtttgttgtgctgcgcggtctttacatggcgatgcaggat
caggatccatttggccgtctggcctcttccggtctgatcgtgatgtttggcctacaaagc
tgcatcaacatggctgtgaacctgaaccttatgccatccaagggtatgacactgccgctg
atttcgtccggtgtgtcttcccttatggcgatttccctgacgatggggtttgtgctggcg
ttgacgcggaagcgaccgcagccgcgtaagaacccgattatcactgttacccgcgctgca
cctttgcagcacgcttag

DBGET integrated database retrieval system