KEGG   Pseudovibrio sp. FO-BEG1: PSE_4650Help
Entry
PSE_4650          CDS       T01669                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:psf00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSE_4650
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PSE_4650
Enzymes [BR:psf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PSE_4650
Two-component system [BR:psf02022]
 CheA family
  CheA-CheYBV
   PSE_4650
Bacterial motility proteins [BR:psf02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PSE_4650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5025888..5027150)
Genome map
AA seq 420 aa AA seqDB search
MDMGRLGMYAKVEEPKTERSGHAAPIRVMVVDDSVVIRGLFSRWIEADPELEVVATHRNG
ELAVKDIERSNPDVVVLDVEMPVMDGLTALPKLLEKKRDLIIVMASTLTRRNAEVSLKAL
SLGATDYVAKPETTGQTASATEFQRELLEKLRLLGRGGKRLKRTTIKPAAEPVRRMRAEI
VNDPHKRRTETSVDRAETRAALRRPRTMGLQSAAKQEITLRPYSSVVPRALVIGSSTGGP
QALQRVLTDARDGLLKVPVVITQHMPRTFTTILAEHLHKQLQLPSKEAEHMDVLKPGHVY
IAPGGIHLKIGKQNGQAVSLLEDGAPVNFCKPSVDPLFESAAEVFGTACLALVLTGMGSD
GANGVNVIAGKGGSVIAQDEASSVVWGMPGAAARTGNCSGIVPLDQIGAQVKRILKGAAR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggatatgggccggctgggcatgtatgcaaaagttgaggagccaaagacggagagatcc
ggtcatgcggcacctatccgggtcatggtcgtagacgattccgttgtcattcgtgggttg
ttcagcagatggattgaggcagatcctgagctggaagttgttgcaactcacagaaatggt
gagttggcagtaaaagacattgaacgcagcaacccggacgttgttgtgctcgacgttgaa
atgcctgtgatggatggcctgacagctcttccgaagcttctagaaaagaaacgcgatctc
atcatcgtgatggcttccacgctgacgcgccggaacgccgaagtaagtttgaaggctctt
tctcttggcgctactgactatgtcgccaagccggaaacaactggccagacagccagtgcg
accgagtttcagagagagctgctggagaaactgcgcttgcttggacgtgggggaaaacgt
cttaagcgcacgaccattaagccagcagctgagcctgtacgcagaatgcgtgcggagatt
gtcaatgacccgcacaaacgacggactgaaacctctgttgaccgggcagagacgcgtgca
gcattgcgccgtccgcggacaatggggcttcaatcagctgcaaagcaagagattacgcta
cggccatattcttcggtcgtgccgagggctcttgtgattggtagctccacgggagggccg
caagcgcttcagcgtgtgctgactgatgcacgcgatggtttgctcaaggttcccgttgtg
atcacgcagcatatgccgcggacgttcacgacaattcttgcggagcatttgcataagcaa
cttcagcttccttcaaaagaagctgagcacatggatgtattgaaacctgggcacgtgtat
atcgcgccaggcggaattcatttgaaaatcggcaagcagaacgggcaggcggtttcgctg
cttgaagacggagctcccgtcaacttctgtaagccatctgtggatccactttttgaaagt
gcagccgaagtattcggtaccgcgtgtttggcactcgttttgaccggcatgggcagtgat
ggcgcaaatggcgtcaatgtaattgccggtaagggcggaagcgtcatagcgcaggatgag
gcctccagtgttgtctggggaatgccaggagctgctgcccgtacagggaactgcagcggc
atcgtgcctcttgatcagattggtgcacaagtcaagcgtatcttaaaaggagccgcgcga
tga

DBGET integrated database retrieval system