KEGG   Pseudovibrio sp. FO-BEG1: PSE_4669Help
Entry
PSE_4669          CDS       T01669                                 

Definition
(GenBank) M42 glutamyl aminopeptidase
Organism
psf  Pseudovibrio sp. FO-BEG1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: AEV39171
UniProt: G8PJ85
Position
complement(5047939..5049024)
Genome map
AA seq 361 aa AA seqDB search
MMWAGSIVELKVTMNIDLLRRLCETPGVPGHEHRVRDLILKEIEGLFDDVQTDAMGSLIC
RRDARRPTKKGEKPKKVMLLCHMDEIGFLVSHITDKGFIYVHPVGGFDARNLFSRRVLVS
TDEGDLKGVMNAAGRPIHIASPEERKKTPEVTDFVIDLGLGEKTKEVVKVGDMVTLDEPL
IEIGEKVVSKALDNRVACWLGIEALRALGDAKHACEIYVAFTCQEEVGLRGAKTAAYAIQ
PDIGLGVDITLACDTPGVSEQDRTTVQGAGFGLHVKDSSFIADLQLVKDIEELAKEEEIP
YQRTMLRIGGQDGAAAQQAAAGAKAVGIVVGTRYVHTVTEMIHKSDLLAARDILAAYLKC
N
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgatgtgggctggttccattgttgagttgaaagttaccatgaatattgatctgctgcgc
cgcctctgcgaaaccccgggtgttcctgggcatgagcatcgagtgcgcgaccttatcctg
aaggaaattgagggcctgtttgatgatgttcaaacggatgcaatgggctctctgatctgt
cgtcgtgatgcgcgtagacctacgaaaaaaggcgagaagccgaagaaggtcatgctgctg
tgtcacatggatgagatcggtttccttgtctctcatatcaccgataaaggcttcatttat
gtgcatccggttggcggctttgatgcgcgtaatttgttctcgcgccgtgtgctggtttca
acggatgaaggtgatctgaaaggggttatgaatgcggctggtcggcctattcatatcgcc
tctcctgaagagcgcaaaaagacaccggaagtgactgactttgttattgatcttggtctt
ggtgaaaagaccaaagaggtggtcaaagtgggtgacatggtgaccctcgatgagccactg
attgagattggtgagaaggtggtttccaaggcgctggataaccgtgtggcgtgctggctt
ggcattgaagctttgcgtgcgctcggtgatgcgaagcatgcctgtgaaatctatgttgcg
ttcacctgtcaggaagaagttggtctgcgcggtgctaagaccgctgcttacgcgatccag
cctgatatcgggcttggtgttgatattacgctggcttgtgacacgccgggtgtgtccgaa
caggatcggacgactgtacagggtgcgggctttggtcttcatgtgaaagacagctccttc
attgctgatttgcagcttgtgaaggacattgaggagttggctaaagaagaagagatccca
tatcagcgcactatgttgaggattggtggtcaggatggagcggctgctcagcaggctgcg
gctggtgcgaaagctgtaggtatcgtggttggaacgaggtatgtgcacactgttacggag
atgatccataagagtgatctactcgctgctcgtgatattctggcagcttatctcaagtgc
aactga

DBGET integrated database retrieval system