KEGG   Pseudovibrio sp. FO-BEG1: PSE_4669Help
Entry
PSE_4669          CDS       T01669                                 

Definition
M42 glutamyl aminopeptidase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSE_4669
Enzymes [BR:psf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     PSE_4669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5047939..5049024)
Genome map
AA seq 361 aa AA seqDB search
MMWAGSIVELKVTMNIDLLRRLCETPGVPGHEHRVRDLILKEIEGLFDDVQTDAMGSLIC
RRDARRPTKKGEKPKKVMLLCHMDEIGFLVSHITDKGFIYVHPVGGFDARNLFSRRVLVS
TDEGDLKGVMNAAGRPIHIASPEERKKTPEVTDFVIDLGLGEKTKEVVKVGDMVTLDEPL
IEIGEKVVSKALDNRVACWLGIEALRALGDAKHACEIYVAFTCQEEVGLRGAKTAAYAIQ
PDIGLGVDITLACDTPGVSEQDRTTVQGAGFGLHVKDSSFIADLQLVKDIEELAKEEEIP
YQRTMLRIGGQDGAAAQQAAAGAKAVGIVVGTRYVHTVTEMIHKSDLLAARDILAAYLKC
N
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgatgtgggctggttccattgttgagttgaaagttaccatgaatattgatctgctgcgc
cgcctctgcgaaaccccgggtgttcctgggcatgagcatcgagtgcgcgaccttatcctg
aaggaaattgagggcctgtttgatgatgttcaaacggatgcaatgggctctctgatctgt
cgtcgtgatgcgcgtagacctacgaaaaaaggcgagaagccgaagaaggtcatgctgctg
tgtcacatggatgagatcggtttccttgtctctcatatcaccgataaaggcttcatttat
gtgcatccggttggcggctttgatgcgcgtaatttgttctcgcgccgtgtgctggtttca
acggatgaaggtgatctgaaaggggttatgaatgcggctggtcggcctattcatatcgcc
tctcctgaagagcgcaaaaagacaccggaagtgactgactttgttattgatcttggtctt
ggtgaaaagaccaaagaggtggtcaaagtgggtgacatggtgaccctcgatgagccactg
attgagattggtgagaaggtggtttccaaggcgctggataaccgtgtggcgtgctggctt
ggcattgaagctttgcgtgcgctcggtgatgcgaagcatgcctgtgaaatctatgttgcg
ttcacctgtcaggaagaagttggtctgcgcggtgctaagaccgctgcttacgcgatccag
cctgatatcgggcttggtgttgatattacgctggcttgtgacacgccgggtgtgtccgaa
caggatcggacgactgtacagggtgcgggctttggtcttcatgtgaaagacagctccttc
attgctgatttgcagcttgtgaaggacattgaggagttggctaaagaagaagagatccca
tatcagcgcactatgttgaggattggtggtcaggatggagcggctgctcagcaggctgcg
gctggtgcgaaagctgtaggtatcgtggttggaacgaggtatgtgcacactgttacggag
atgatccataagagtgatctactcgctgctcgtgatattctggcagcttatctcaagtgc
aactga

DBGET integrated database retrieval system