KEGG   Pseudovibrio sp. FO-BEG1: PSE_4684Help
Entry
PSE_4684          CDS       T01669                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:psf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PSE_4684 (ruvA)
Enzymes [BR:psf01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PSE_4684 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5065552..5066166)
Genome map
AA seq 204 aa AA seqDB search
MIGKLKGVVDSYGDDFVLLDVQGVCYQVHCPSRVLQQLPRVGEAAVLAIETMVREDMIKL
FGFAEDSEREWFRILMTVQGVGAKVALGILGIMKASEVANAIALGDKTAITRAPGVGKRV
AERIVTELKDKAPAFASVEDDTIAVSQSVAENVASRPVADAVSALSNLGYQPAQASAAVA
AAVKTAGEDASAEKLIRLGLKELA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatcgggaaactcaagggtgtcgtcgatagttacggcgatgatttcgtgctgctggat
gtgcagggcgtttgctatcaggtgcattgcccttctcgcgtgttgcagcagttgccgcgt
gtgggcgaagctgctgtgctggccattgagaccatggtgcgtgaagacatgatcaagctg
tttggctttgccgaggacagcgagcgtgaatggttccgtattctcatgaccgttcagggt
gttggtgccaaggttgcgctgggcattctgggcatcatgaaagcctctgaagtggcgaac
gcgattgcgctgggcgataagactgcgattacgcgcgcaccgggtgttggcaagcgtgtg
gctgagcgtattgtgaccgaactgaaagacaaggcaccggcctttgcttctgttgaggat
gacacgatcgcggtttcccagagtgttgcagagaatgtggcctctcgtccggtggcggat
gcggtgtctgcactctccaacctcggttaccagccagctcaggcctctgctgctgtggca
gctgctgtgaaaactgcgggtgaggatgcgagtgctgaaaaacttattcgccttggcctt
aaggaacttgcgtaa

DBGET integrated database retrieval system