KEGG   Pseudovibrio sp. FO-BEG1: PSE_4973Help
Entry
PSE_4973          CDS       T01669                                 

Definition
Enoyl-CoA hydratase/isomerase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PSE_4973
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSE_4973
   00650 Butanoate metabolism
    PSE_4973
  Lipid metabolism
   00071 Fatty acid degradation
    PSE_4973
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSE_4973
   00310 Lysine degradation
    PSE_4973
   00360 Phenylalanine metabolism
    PSE_4973
   00380 Tryptophan metabolism
    PSE_4973
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSE_4973
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSE_4973
   00281 Geraniol degradation
    PSE_4973
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSE_4973
   00627 Aminobenzoate degradation
    PSE_4973
   00930 Caprolactam degradation
    PSE_4973
Enzymes [BR:psf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PSE_4973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5362917..5363774)
Genome map
AA seq 285 aa AA seqDB search
MAKVLYEKDGRIARITLNRPDVMNAIDMDIPHELAACVTRANADDGVHVIVLGGNGPAFC
AGYDLTAYAETEGCNPGVQEMPWDPMKDYAFMKQNTDLFMSLWRSYRPVIAKVHGHAVAG
GSDIALCSDMIVMSEDAHIGYMPVRVWGCPTTAMWVYRLGAERAKRMLLTGDKIDGREAE
RIGLVQKAVPADQLDAEVERLAERMAGIPVNQLMMQKLMINQAIESMGLYQTQMIATLFD
GITRHSPEGMNFKKRAEDVSWKQAVRERDQGTFDWTANRPINAPL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggtactttatgagaaagacggtcggattgcgcgcattacattaaaccgacct
gatgtgatgaatgccattgatatggatattccgcatgagttggctgcctgtgtgacacga
gccaatgcagatgacggtgttcatgtgatcgtgctgggaggaaacggcccggcgttttgt
gcaggttatgatctgacggcttatgccgaaaccgaaggctgcaacccgggtgttcaagaa
atgccatgggatccgatgaaggactatgccttcatgaagcagaacacggacctgttcatg
tcattatggcgcagttaccggcctgttattgctaaggtgcatggccatgccgttgctggc
ggttcagatattgctctttgctcagatatgattgtgatgtcggaagatgctcacatcggc
tacatgcccgtgcgtgtttggggctgtccaacgactgcaatgtgggtataccggcttggt
gctgaacgtgcgaagcgtatgctgctaacaggtgacaagattgatggccgtgaggctgag
cgcattggactggttcaaaaggcagtgccagctgatcagcttgatgcggaagttgaaaga
ctggccgagcgtatggcaggcattccagtaaaccagttgatgatgcaaaaactcatgatc
aatcaggcgatcgagtccatggggctttaccagacacaaatgattgccacgctgtttgat
ggtattactcgacatagcccggaagggatgaacttcaagaaacgagctgaagatgtctcc
tggaagcaggctgttcgtgagcgtgatcaaggtacttttgactggaccgcaaacagaccg
ataaatgctcctctataa

DBGET integrated database retrieval system