KEGG   Pseudovibrio sp. FO-BEG1: PSE_4995Help
Entry
PSE_4995          CDS       T01669                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
psf00010  Glycolysis / Gluconeogenesis
psf00620  Pyruvate metabolism
psf00640  Propanoate metabolism
psf00680  Methane metabolism
psf01100  Metabolic pathways
psf01110  Biosynthesis of secondary metabolites
psf01120  Microbial metabolism in diverse environments
psf01130  Biosynthesis of antibiotics
psf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSE_4995
   00620 Pyruvate metabolism
    PSE_4995
   00640 Propanoate metabolism
    PSE_4995
  Energy metabolism
   00680 Methane metabolism
    PSE_4995
Enzymes [BR:psf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PSE_4995
Lipid biosynthesis proteins [BR:psf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PSE_4995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEV39497
UniProt: G8PNK5
Position
5385258..5386889
Genome map
AA seq 543 aa AA seqDB search
MLPSANTYEELREKFQWDIPEFFNIGVDICDKWADKDAAREALIFAEEEGPTTTYTFGDL
KKLSNQLANLLVSQGITRGDRVGILLPQAPETAFSHIAIHKLGGISIPLFSLFGEEALEY
RLGNSGAKALITNNAGAAKLEKIRENLPELELILNIEGTDFGNRSLHAEMAEQSEDFTPV
KTKAEDPAIIIYTSGTTGQPKGALHAHRTLLGHLPGVEMPHNMFPKEGDRFWTPADWAWI
GGLIDVLLPSLHHGVTVVACRFKKFSGEAAFQLMQDLRIRNAFIPPTALKMMRQVENPKD
RWNYSLRSLGSGGEALGAELIQWGRDTFGLTISEFYGQTECNLVVSTCAELMETRPGVTG
KAVPGFDVQIVDDNGTILETGQLGNIGVRAPNPVMFLQYWNNPEATKKKFSGDFLITGDK
GVMDKDGWIQFVGRDDDVITSSGYRIGPGEIEDCLLKHDAVAMAGVIGKPDKLRTEIVKA
YIVLKEGMEPSDELAKELSEFVKQRLAAHEYPRELEFVEALPMTTTGKVIRRELRARAID
EEV
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
ttgttgccatctgcgaatacctatgaggagctccgagaaaagtttcagtgggacatcccg
gagttcttcaacatcggcgtagatatctgtgacaagtgggcggacaaagatgccgcccgc
gaagcactcatcttcgctgaagaagaagggccaacaaccacctacacgttcggtgacttg
aaaaagctgagcaatcagctggccaacctgctcgtttcacaaggcatcactcgcggtgat
cgtgttggcatcctgttgccgcaagcgccagaaacagccttctcccatatcgcaattcac
aagctcggcggcatctccattccgctcttctccctgtttggcgaagaggcactggagtac
cgactaggtaactccggcgccaaagctctcatcaccaacaacgctggtgctgcaaagctt
gaaaagatccgcgaaaacctgcctgagcttgaactgatcctgaacatcgagggcactgac
ttcggcaaccgttcgctccatgctgaaatggcagagcagagcgaagacttcaccccggta
aagaccaaagccgaagatcctgccatcatcatctacacctccggcaccacaggccagccg
aaaggcgcgctgcacgcgcaccgcacgctgctcggccacctgcccggcgtggagatgccg
cacaacatgttcccgaaggaaggtgatcgcttctggacacctgcagactgggcatggatt
ggcggtttgattgatgttctcctgccgagcctgcaccacggtgttacagtcgtcgcctgt
cgcttcaaaaagttcagcggcgaagcagcttttcagctgatgcaggatctgagaattcgc
aatgccttcatcccaccaaccgcgttgaagatgatgcggcaggttgagaacccgaaggac
cgctggaactattctctccgctctctcggcagtggtggcgaagcccttggcgcagaactg
atccaatggggccgcgatacatttggcctgacaatcagcgagttttacggccagaccgaa
tgcaatctggttgtttccacctgcgcagagctgatggaaacccgccccggtgtcaccggc
aaagccgtgccgggctttgatgtacagatcgtagacgacaacggcaccattctggaaacc
ggtcagctcggcaacatcggcgttcgcgctccaaaccctgttatgttcctgcaatactgg
aacaacccggaagccacgaagaagaagttctccggcgacttcctcatcacgggcgataaa
ggcgtgatggacaaggacggctggatccagtttgttggccgcgatgatgatgtcatcaca
tcttccggctatcgcatcggcccgggtgagattgaagactgcctgctgaaacatgacgct
gttgccatggcaggtgtgatcggcaaaccggacaaactgcgaactgagatcgtcaaagcc
tacattgtgctgaaggaaggtatggagccttccgatgaactcgccaaggaactatctgag
tttgttaagcagcgtctggctgctcatgaatatccaagagaactggaatttgtcgaagcc
ctgccaatgacaacaaccggtaaggtaatccgcagagaacttcgtgcccgcgctatcgac
gaggaggtttga

DBGET integrated database retrieval system