KEGG   Pseudovibrio sp. FO-BEG1: PSE_5046Help
Entry
PSE_5046          CDS       T01669                                 

Definition
Di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
psf  Pseudovibrio sp. FO-BEG1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5435536..5436609)
Genome map
AA seq 357 aa AA seqDB search
MRLLVGMSIALMTSTAAFATDLGPVAKIEQNPALVELGKRLFYDSRLSGDTNLSCSTCHD
PAKAFTDGEQLSTAYTGTEGFRNTPTLANVGHRAAWMHDGRLGTNLNDVSRGMITETYIM
NMDMRIMQERFKQDPVYVEMFKAAGKGEPSNGGARGALEAFLKSITSQGSAFDRGELTVA
ERRGYELFMGKAGCSSCHSGNRFTDDQPHNTGVPNNPDIWSDPLRHITYVTYAKFMGVEN
YMNLREDQGAYIRDHKEENKRSFLTPTLRELTYTAPYMHNGMLATLEDVVEFYNQGGGDD
VNKDLRLKPLNLKNSEKANLVAFLKSLSGDSFDTPEYVWTADDYSYELIEDWKNKKN
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcgccttctcgtcggtatgtcgattgctttgatgacaagcactgcggcattcgcaaca
gatttagggcctgttgcaaaaattgagcagaatcctgctctcgtagaactgggaaaacgc
ttattctatgatagccgtttgtctggtgacaccaaccttagctgttcaacatgtcatgat
ccagctaaggcgttcacagatggcgagcagctttctaccgcatatacaggtacagaaggt
ttccgtaacacgccaacactggcgaacgtcggacaccgtgctgcatggatgcatgatggc
cgtttgggtacaaacctgaacgacgtgtctcgtggtatgatcaccgagacctacatcatg
aacatggatatgcgtattatgcaggagcgctttaaacaggatcctgtttacgttgaaatg
tttaaagctgcgggcaagggcgaaccatccaacggtggtgctcgtggtgctttggaagca
ttccttaaatccattacatctcaaggttccgcgtttgaccgtggtgagctgaccgtcgct
gagagacgcggttatgaactcttcatgggcaaagcaggatgttcttcctgtcactccggc
aaccgcttcactgatgatcagccacacaataccggtgttccaaacaacccagatatctgg
tctgatccactgcgtcacatcacctatgtgacttatgcgaagttcatgggcgtagaaaac
tacatgaacctgcgtgaagatcagggtgcatacatccgggatcacaaagaagagaacaag
cgttccttcctgaccccaactcttcgtgagctgacctacaccgcgccttacatgcacaac
ggcatgctggcgacccttgaagacgttgtagaattctacaaccagggtggtggtgatgat
gtcaacaaagacttacgtctgaagccactcaacctgaagaatagcgaaaaagccaatctg
gtcgcgttccttaagtccttgtctggcgacagcttcgatactcctgaatacgtttggaca
gccgacgactactcttacgagttgatcgaagactggaaaaacaagaagaactag

DBGET integrated database retrieval system