KEGG   Pseudomonas aeruginosa B136-33: G655_01340Help
Entry
G655_01340        CDS       T02627                                 

Definition
4-aminobutyrate aminotransferase (EC:2.6.1.19)
Orthology
K14268  
5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
psg  Pseudomonas aeruginosa B136-33
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psg00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    G655_01340
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    G655_01340
   00310 Lysine degradation
    G655_01340
Enzymes [BR:psg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     G655_01340
    2.6.1.48  5-aminovalerate transaminase
     G655_01340
Amino acid related enzymes [BR:psg01007]
 Aminotransferase (transaminase)
  Class III
   G655_01340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
291654..292934
Genome map
AA seq 426 aa AA seqDB search
MSKTNESLLKRRQAAVPRGVGQIHPVVAERAENSTVWDVEGREYIDFAGGIAVLNTGHLH
PKVIAAVQEQLGKLSHTCFQVLAYEPYIELAEEIAKRVPGDFPKKTLLVTSGSEAVENAV
KIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALAPCELHGVS
EDDSIASIERIFKNDAQPQDIAAIIIEPVQGEGGFYVNSKSFMQRLRALCDQHGILLIAD
EVQTGAGRTGTFFATEQLGIVPDLTTFAKSVGGGFPISGVAGKAEIMDAIAPGGLGGTYA
GSPIACAAALAVLKVFEEEKLLERSQALGERLKAGLREIQAKHKVIGDVRGLGSMVAIEL
FEGGDTHKPAAELVSKIVVRAREKGLILLSCGTYYNVIRFLMPVTIPDAQLEKGLAILAE
CFDELA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaccaacgaatccctgctgaagcgtcgccaggccgcggtaccccgcggcgtg
ggccagatccacccggtcgtcgccgagcgcgccgagaactccaccgtctgggacgtggaa
ggccgcgagtacatcgacttcgccggcggcatcgccgtgctgaacaccggccacctgcat
ccgaaggtgatcgccgcggtccaggagcaactgggcaagctgtcccacacctgcttccag
gtgctggcctacgaaccctacatcgagctggccgaggaaatcgccaagcgcgtgccgggc
gacttcccgaagaagaccctgctggtcacctccggctccgaagccgtcgagaacgccgtc
aagatcgcccgcgccgccaccggtcgcgctggcgtgatcgccttcaccggcgcctaccac
ggccgcaccatgatgaccctgggcctgaccggcaaggtggtcccgtactccgccggcatg
ggcctgatgccgggcggcatcttccgcgccctggcgccctgcgaactgcacggcgtgagc
gaggacgactccatcgccagcatcgagcgcatcttcaagaacgatgcccagccccaggac
atcgccgcgatcatcatcgagccggtgcagggcgagggtggcttctacgtcaactccaag
tccttcatgcagcgcctgcgcgccctgtgcgaccagcacggcatcctgctgatcgccgac
gaagtgcagaccggcgccggccgtaccggcaccttcttcgctaccgagcaactgggcatc
gttcctgacctgaccaccttcgccaagtcggtcggcggcggcttcccgatctccggcgtg
gccggcaaggccgagatcatggacgccatcgcgcccggcggcctgggcggcacctatgcc
ggcagcccgatcgcctgcgccgcggccctggccgtgctgaaggtgttcgaggaagagaag
ctgctggaacgttcgcaagccctcggcgagcgcctcaaggccggcctgcgcgagatccag
gccaagcacaaggtgatcggcgacgttcgtggcctgggttcgatggtggccatcgagctg
ttcgagggcggcgatacccacaagccggccgccgagctggtcagcaagatcgtcgtccgt
gcgcgcgagaagggcttgatcctgctctcctgcggcacctactacaacgtcatccgcttc
ctcatgcccgtcaccatccccgacgcgcaactggagaagggcctggccatcctggccgag
tgcttcgacgaactcgcttaa

DBGET integrated database retrieval system