KEGG   Pseudomonas aeruginosa B136-33: G655_03525Help
Entry
G655_03525        CDS       T02627                                 

Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
psg  Pseudomonas aeruginosa B136-33
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psg00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    G655_03525
  Amino acid metabolism
   00380 Tryptophan metabolism
    G655_03525
Enzymes [BR:psg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     G655_03525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
734284..735732
Genome map
AA seq 482 aa AA seqDB search
MEEKTRLTTAAGAPVVDNQNVQTAGPRGPMLLQDVWFLEKLAHFDREVIPERRMHAKGSA
AYGTFTVTHDITPYTRAKIFSQVGKKTDMFLRFSTVAGERGAADAERDIRGFSMRFYTEQ
GNWDLVGNNTPVFYLRDPLKFPDLNHVVKRDPRTNLRNATFKWDFFSHLPESLHQLTIDF
SDRGLPKSYRHIHGFGSHTFSFINANNERFWVKFHFKTQQGIENLTNAEAAEVIAQDRES
SQRDLYESIEKGDFPRWKMYVQIMPEKEAATYRYNPFDLTKVWPHGDYPLIEVGFFELNR
NPDNYFAEVEQAAFTPANVVPGIGFSPDKMLQGRLFSYGDAHRYRLGVNHHQIPVNAARC
PHQVYHRDGGMRVDGNNAHQRVTYEPNSFNQWQEQPDFSEPPLSLEGAADHWNHRVDDDY
YSQPAALFHLFTDEQKQRLFANIAEDIRDVPEQIQRRQIGLFLKVDPAYGKGVADALGLK
LD
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaagacccgcctgaccactgccgctggcgcaccggtggtcgataaccagaac
gtgcagaccgccggtccgcgtggcccgatgttgctgcaggacgtgtggttcctcgagaag
ctcgcccacttcgatcgcgaagtgatccccgagcgacgcatgcatgcgaaaggctccgcg
gcctacggcaccttcaccgtcacccatgacatcaccccctacacccgggcgaagatcttc
tcccaggtcggcaagaagaccgatatgttcctgcgcttctccaccgtcgccggtgagcgt
ggcgcggcggatgccgagcgagacatccgcggcttctccatgcgtttctacaccgagcag
ggcaactgggacctggtcggcaacaacaccccggtgttctatctgcgcgacccgctcaag
ttccccgatctcaaccacgtggtgaagcgtgacccgcgcaccaacctgcgcaatgcgacc
ttcaagtgggactttttctctcacctccccgagtcgctgcatcagttgaccatcgacttc
agcgaccgcggtctgccgaagagctatcggcacatccatggtttcggcagccataccttc
agcttcatcaatgcgaacaacgagcgcttctgggtcaagttccacttcaagacccaacag
ggcatcgagaacctgaccaacgccgaggctgccgaagtgatcgcccaggaccgcgagagt
tcgcagcgcgacttgtacgagagcatcgagaaaggcgacttcccgcgctggaagatgtac
gtgcagatcatgcccgagaaggaagcggccacctatcgctacaacccgttcgacctgacc
aaggtctggccccacggtgactacccgttgatcgaagtgggcttcttcgagctgaaccgt
aacccggacaactacttcgccgaggtcgagcaggccgctttcacgccggccaacgtggtg
cccggtatcggtttctcgccggacaagatgctccagggccgtctgttctcctacggcgac
gcccatcgctatcgcctgggcgtcaaccaccaccagatcccggtgaacgccgcgcgttgc
ccgcaccaggtctaccaccgcgacggcggcatgcgggtggacggcaacaacgcccatcag
cgcgtcacctacgagccgaacagcttcaaccagtggcaggagcagcctgacttctccgag
ccgccgctgagcctggagggggcggcggaccactggaaccaccgggtggacgacgactac
tacagccagccggccgcgctgttccatctgttcaccgacgagcagaagcagcggctgttc
gccaacatcgccgaagacatccgcgatgtaccggaacagatccagcgtcgccagatcggc
ctgttcctcaaggtcgacccggcctacggcaaaggcgtcgccgacgccctcggcctgaag
ctggactga

DBGET integrated database retrieval system