KEGG   Pseudomonas aeruginosa B136-33: G655_06105Help
Entry
G655_06105        CDS       T02627                                 

Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
psg  Pseudomonas aeruginosa B136-33
Brite
Enzymes [BR:psg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     G655_06105
Secretion system [BR:psg02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   G655_06105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1307504..1308232
Genome map
AA seq 242 aa AA seqDB search
MRVTRFLAAAALGLMSTLALADNADQNIRKTLQALQPDLPIDSIASSPLQGLYQVQLKGG
RVLYASADGQFVMQGYLYQVKDGKPVNLTEKAESQAIAKAINGVPASEMVVYPAKGQAKA
HITVFTDTTCPYCQKLHAEVPDLTEQGIEVRYMAFPRQGPQSAGDKQLQAVWCAKEPTKA
MDAMMNGKEIKSSECKNPVDKQFQMGQMVGVQGTPAIVLANGQLLPGYQPAKQLAKLALE
AK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgacccgttttctggctgctgccgccctcggcctgatgagtaccctggccctg
gcagacaatgccgatcagaacatccgcaagaccctgcaggccctgcagccggacctgccc
atcgactccatcgccagcagcccgctgcaggggctctaccaggtgcagctgaagggcggc
cgggtgctctacgccagcgccgacggccagttcgtcatgcagggctacctctaccaggtg
aaggacggcaagccggtcaacctgaccgagaaggccgagagccaggcgatcgccaaggcg
atcaacggcgtgcccgccagcgagatggtggtgtatccggccaagggccaggccaaggcg
cacatcacggtgttcaccgataccacctgcccgtactgccagaagctgcatgccgaagtg
ccggacctgaccgagcaggggatcgaggtgcgctacatggcgttcccgcgccaggggccg
cagtcggcgggcgacaagcaactgcaggcggtctggtgtgcgaaggagccgaccaaggcg
atggacgccatgatgaacggcaaggagatcaagtcttccgagtgcaagaacccggtcgac
aagcagttccagatgggccagatggtcggggtgcagggaacgccggcgatcgtcctcgcc
aacggccagttgctccccggctaccagccggccaagcagttggccaagctggcgctggag
gccaagtag

DBGET integrated database retrieval system