KEGG   Pseudomonas aeruginosa B136-33: G655_14350Help
Entry
G655_14350        CDS       T02627                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
psg  Pseudomonas aeruginosa B136-33
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:psg00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3163142..3165340)
Genome map
AA seq 732 aa AA seqDB search
MSEPMSERERWQLELDKLQRGLQGDPFAFLGPQRDPGGEGGVLRAYLPGAQRVELLDEDG
ATLAELEQSDPGSGLFQRHLERLPPRYRLRVHWPDGVQESEDPYAFGPLLGELDLYLFAE
GNHRQLASCLGAQLTRHEGVEGVRFAVWAPNAVRVSVVGDFNGWDGRRHPMRRRYPSGVW
ELFVPRLGEGELYKYELQGHDGLLPLKADPLALACETPPGTASKTCAALRHEWRDQDWLA
RRAERQGYAAPLSIYEVHAGSWRHRDGRPPHWSELAEELIPYVRQLGFTHIELMPVMEHP
FGGSWGYQPLGLFAPTARYGTPEDFAAFVDACHHAGIGVILDWVPAHFPTDAHGLGRFDG
TALYEYEHPFEGFHQDWDTYIYNLGRSEVHGFMLASALHWLRTYHVDGLRVDAVASMLYR
DYSRKEGEWLPNRHGGRENLEAIDFLHHLNQVVASETPGALVIAEESTAWPGVSRPVAEG
GLGFSHKWNMGWMHDSLAYIGEDPLHRRYHHHQLTFGLLYAFSEHFILPISHDEVVHGKH
SLLDKMPGDRWQKFANLRLYLSFMWSHPGKKLLFMGCEFGQWREWNHDGELDWYLLRYPE
HQGVQDLVAALNRLYRELPALHARDGEALGFEWLIGDDQANSVYAWLRHAAGEPSLLAVH
NFTPVPRQGYRIGVAQGGDWDVLLNSDAQAFAGSGSGSQGRVSSESCGAHGQAQSLLLDL
PPLGTLLLRPAG
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaccgatgtccgaacgcgaacgctggcaactggagctggacaagctgcagcgc
ggcctgcagggcgatccattcgccttcctcggcccgcagcgcgaccccggcggcgaaggc
ggcgtgctgcgcgcctacctgcccggcgcgcagcgcgtcgagctgctcgacgaagacggc
gcgacgctcgccgaactggagcagagcgaccccggcagcggcttgttccagcgccacctg
gagcgcctgccaccgcgctaccgcctgcgcgtgcactggccggacggcgtgcaggaaagc
gaagacccctatgccttcgggccgttgctcggcgaactcgacctctacctgttcgccgaa
ggcaaccaccgccaactggcctcctgcctgggcgcgcaactgacccgtcacgaaggcgtg
gagggcgtgcgcttcgcggtctgggcgccgaacgccgtgcgcgtctcggtggtcggcgat
ttcaacggctgggacgggcgccgtcacccgatgcgacgacgctatccatccggcgtctgg
gaactgttcgtcccgcgcctcggcgagggcgaactgtacaagtacgagttgcagggccac
gacggcctcctgccgctgaaggccgaccccctggcgctggcctgcgagacgccgcccgga
accgcttcgaagacctgcgcggcgttgcgccacgagtggcgcgaccaggactggctggcc
cggcgcgcggagcgccagggctatgcggcaccgctgtcgatctacgaagtccacgccggc
tcctggcgccaccgcgacggccggccgccgcactggtcggaactggcggaggagctgatt
ccctacgtgcgccagctcggcttcacccatatcgagctgatgccggtgatggaacatccc
ttcggcggctcctggggctaccagccgctcgggttgttcgcccccaccgcgcgctacggc
acgccggaggacttcgccgcgttcgtcgacgcctgccaccatgccggcatcggcgtgatc
ctcgactgggtgccggcgcattttcccaccgacgcccacggcctgggccgtttcgacggc
acggcgctgtacgagtacgaacatcccttcgaaggcttccaccaggactgggatacctac
atctacaaccttggccgcagcgaggtgcacggcttcatgctggcctcggcgctgcactgg
ctgcgcacctaccacgtcgacggcctgcgggtggatgcggtggcctcgatgctctatcgc
gactattcgcgcaaggaaggcgaatggctgccgaaccgccatggcggccgggagaacctg
gaggccatcgacttcctccatcacctcaaccaggtggtcgccagcgaaacccccggcgcg
ctggtgatcgccgaggaatccaccgcctggcccggcgtcagccgtccggtggcggagggc
ggcctgggcttcagccataagtggaacatgggctggatgcacgacagcctggcgtacatc
ggcgaagacccgctgcaccggcgctatcaccaccaccagttgaccttcggcctgctctac
gccttctccgagcatttcatcctgccgatctcccacgacgaggtggtacatggcaagcac
tcgctactggacaagatgcccggcgaccgctggcagaagttcgccaacctgcgcctgtac
ctgagcttcatgtggtcgcacccgggcaagaagctgctgttcatgggatgcgagttcggc
cagtggcgcgagtggaaccacgacggcgaactggactggtacctgctgcgctatccggag
catcagggcgtacaggacctggtggcggccctcaaccggctgtaccgcgaactccccgca
ctgcatgcgcgcgacggcgaggcgctcggcttcgaatggctgatcggcgacgaccaggcg
aacagtgtctacgcctggctgcgccacgcggccggcgagccatcgctgctggcggtacac
aatttcaccccggtgccgcgccagggctatcggatcggcgtagcgcaaggcggcgactgg
gacgtgctgctcaatagcgacgcccaggcgttcgccggttccggctcaggcagccagggc
cgcgtctccagcgagtcgtgcggcgcccatggccaggcgcagtcgctgctgctcgacctg
ccgccgctgggcacgctgctgctgcgtccggccggctga

DBGET integrated database retrieval system