KEGG   Pseudomonas aeruginosa B136-33: G655_27180Help
Entry
G655_27180        CDS       T02627                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
psg  Pseudomonas aeruginosa B136-33
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:psg00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:psg00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5967559..5968104
Genome map
AA seq 181 aa AA seqDB search
MKATRLAIPDVILFEPRVFGDDRGFFFESYNQRAFEEACGHPVSFVQDNHSRSARGVLRG
LHYQIRQAQGKLVRATLGEVFDVAVDLRRGSPTFGHWVGERLSAENKRQMWIPAGFAHGF
VVLSEYAEFLYKTTDFWAPEHERCIVWNDPELKIDWPLQDAPLLSEKDRQGKAFADADCF
P
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgacccgcctggcaatccccgacgtcatcctcttcgaaccccgggtgttcggc
gacgatcgcggattcttcttcgaaagctacaaccagcgcgccttcgaggaggcctgcggt
catccggtcagcttcgtccaggacaaccattcgcgttccgcccgtggcgtcctccgcggc
ctgcactaccagatccggcaagcccagggaaaactggtgcgcgccaccctcggcgaggta
ttcgacgtggccgtcgacctgcgtcgcggctcgccgaccttcggccactgggtaggcgaa
cgcctgagcgcggagaacaagcgccagatgtggattccggccggcttcgcgcacggcttc
gtggtgctcagcgaatacgccgagttcctctacaagaccaccgacttctgggcgccggaa
cacgaacgctgcatcgtctggaacgatcccgagctgaagatcgactggccgctgcaggat
gcccccctgctttcggagaaggaccgccagggcaaggcattcgccgacgccgactgcttc
ccctga

DBGET integrated database retrieval system