KEGG   Pseudomonas stutzeri RCH2: Psest_0135Help
Entry
Psest_0135        CDS       T02391                                 

Definition
aldose 1-epimerase-like enzyme
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psest_0135
Enzymes [BR:psh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Psest_0135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(134749..135651)
Genome map
AA seq 300 aa AA seqDB search
MPVDIQRIEMNQLVCWRVRRGEDELLIAEQGAQILSYRQGDAPPIIWLSEEAAFEQGQSV
RGGVPVCWPWFGDLARNPQAVQANYSGEQPAPFHGLVRALPWQLREQRSEGDTAILEFHC
PQALGELPGLPHRVELTLQIRLADELELSLSSRNVGVEAISISQALHSYFAVSDIHQVRV
EGLAGCPYIDTLLDWQQRQQQNGDLAFNGETDRIYLQLPTTLQLIDPAWKRSIRLTTRGS
RSAVLWNPWIDKAKRLSSYADDAWQRMACIETANVLDDVVVLQPGQQHLLGVSITADPAH
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcgatatccaacgcatcgaaatgaaccagcttgtctgctggcgagtacgtcgc
ggtgaggacgaactgctgatcgccgaacagggcgcgcagatcctcagctatcgccagggc
gatgcgccgccgatcatctggctcagcgaggaggccgccttcgaacagggccaatcggta
cgcggcggtgtgccagtgtgctggccatggttcggcgacctggcgcgcaacccgcaagcg
gtgcaggcgaattacagcggcgagcaacccgcacccttccacggcctggtacgcgccctg
ccctggcaattgcgggagcagcgcagcgaaggcgatacggcgattctcgagttccactgc
ccgcaggcgctcggcgagctgccgggcttgccgcatcgggtcgaactgacgctgcagatc
cgtctggccgatgagcttgagctcagcctcagcagccgcaacgtcggcgtggaggcgatc
agtatcagccaggccctgcacagctacttcgctgtcagcgacatccatcaggtgcgcgtc
gaaggcctggccggctgcccctacatcgatacgctgctggattggcagcagcgccagcag
cagaacggtgacctggcgttcaacggcgaaaccgaccgcatctacttgcagcttccgaca
accctgcagctcatcgacccggcatggaaacgcagcatccggctgaccactcgcggctcg
cgctccgccgtactgtggaacccgtggatcgacaaggccaagcgcctgtccagctacgcc
gacgacgcctggcagcgcatggcctgcatcgagacggccaacgtgctggacgacgtggtg
gtattgcagccaggccagcagcacctgttaggcgtatccatcaccgcagaccccgcgcac
tga

DBGET integrated database retrieval system