KEGG   Pseudomonas stutzeri RCH2: Psest_0135Help
Entry
Psest_0135        CDS       T02391                                 

Definition
(GenBank) aldose 1-epimerase-like enzyme
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00010  Glycolysis / Gluconeogenesis
psh01100  Metabolic pathways
psh01110  Biosynthesis of secondary metabolites
psh01120  Microbial metabolism in diverse environments
psh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psest_0135
Enzymes [BR:psh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Psest_0135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AGA84748
UniProt: L0GDD2
Position
complement(134749..135651)
Genome map
AA seq 300 aa AA seqDB search
MPVDIQRIEMNQLVCWRVRRGEDELLIAEQGAQILSYRQGDAPPIIWLSEEAAFEQGQSV
RGGVPVCWPWFGDLARNPQAVQANYSGEQPAPFHGLVRALPWQLREQRSEGDTAILEFHC
PQALGELPGLPHRVELTLQIRLADELELSLSSRNVGVEAISISQALHSYFAVSDIHQVRV
EGLAGCPYIDTLLDWQQRQQQNGDLAFNGETDRIYLQLPTTLQLIDPAWKRSIRLTTRGS
RSAVLWNPWIDKAKRLSSYADDAWQRMACIETANVLDDVVVLQPGQQHLLGVSITADPAH
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcgatatccaacgcatcgaaatgaaccagcttgtctgctggcgagtacgtcgc
ggtgaggacgaactgctgatcgccgaacagggcgcgcagatcctcagctatcgccagggc
gatgcgccgccgatcatctggctcagcgaggaggccgccttcgaacagggccaatcggta
cgcggcggtgtgccagtgtgctggccatggttcggcgacctggcgcgcaacccgcaagcg
gtgcaggcgaattacagcggcgagcaacccgcacccttccacggcctggtacgcgccctg
ccctggcaattgcgggagcagcgcagcgaaggcgatacggcgattctcgagttccactgc
ccgcaggcgctcggcgagctgccgggcttgccgcatcgggtcgaactgacgctgcagatc
cgtctggccgatgagcttgagctcagcctcagcagccgcaacgtcggcgtggaggcgatc
agtatcagccaggccctgcacagctacttcgctgtcagcgacatccatcaggtgcgcgtc
gaaggcctggccggctgcccctacatcgatacgctgctggattggcagcagcgccagcag
cagaacggtgacctggcgttcaacggcgaaaccgaccgcatctacttgcagcttccgaca
accctgcagctcatcgacccggcatggaaacgcagcatccggctgaccactcgcggctcg
cgctccgccgtactgtggaacccgtggatcgacaaggccaagcgcctgtccagctacgcc
gacgacgcctggcagcgcatggcctgcatcgagacggccaacgtgctggacgacgtggtg
gtattgcagccaggccagcagcacctgttaggcgtatccatcaccgcagaccccgcgcac
tga

DBGET integrated database retrieval system