KEGG   Pseudomonas stutzeri RCH2: Psest_0188Help
Entry
Psest_0188        CDS       T02391                                 

Definition
(GenBank) diguanylate cyclase (GGDEF) domain-containing protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
psh  Pseudomonas stutzeri RCH2
Brite
Enzymes [BR:psh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Psest_0188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
183244..185142
Genome map
AA seq 632 aa AA seqDB search
MSEEAERWKEKYLQLVERQDQLEARWEQRVDLLRRSLVRSSLAVEGADPAVERCLHAMRE
VLREGDLDDGLSQLVPRLEKAVLDSERYRQERAVRLTEALHRLVAQLLALSPPPELRKPI
KRFAKQLDQRAAQLRELPGLLGELSVLQGQVLTLQEDAAPQQGGFLKRLFGGRDSQLAAI
PLETAIPAGLSAPAEVTLAAEAVVGGETAVASAATEAVVAVVAPILAEPANDEQQAVEPV
SSAAEPDADAVEAGADADADAELAPVAEPLPPESAYALPDSPEPAFSVVADRVEATLSNL
LDNLHLPEQHQPQLQTLRARIQHGLNWYELVPVLDDLAMLMIAFSDQGQRDFESYLQTLN
ERLSAMQENLLAAHQGHSEGRDAAQALDEELREQVGGLQHSMRQATDLTSLKKVVEARLD
GLLDTVDTYRQQRSQQEQKLGERLQQLVSRVGSLEQAARGLRGHLEEQRQKALQDPLTGL
PNRAAWNERLDLEFARWQRYGGDLLLAVLDVDHFKRVNDGYGHLAGDRVLKIIGSELRKR
LRKTDFIARFGGEEFVVLLPNTPYEAGQQLMDALRDSISNCPFHFKGERIVITLSAGLTA
FGEDDTTERAFERADGALYRAKNAGRNRVELA
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagaagccgaacgctggaaggaaaagtatcttcagctcgtcgagcgccaggac
cagctggaagcccgctgggaacagcgcgtggatctgctacggcgcagtctggtgcgcagc
agtctggcggtggaaggtgccgaccccgcggtcgagcgctgtctgcatgcgatgcgtgag
gtgctgcgcgagggcgatctggacgatggcctcagccagttggtgccgcgtctggaaaag
gccgtactcgattccgagcggtatcggcaggagcgcgcggtgcggttgaccgaggcactg
catcgcctggtcgcccagctgctggcactctcgcctccgccggaactgcgcaagcctatc
aagcgctttgccaaacagctggaccagcgcgccgctcagctccgcgagctgccggggctg
cttggtgagttgagtgttttgcaaggccaggtgctgacgctgcaggaggatgccgcgccg
cagcagggtggatttctgaagcgcctgttcggtggccgggacagccagttggcggcgatc
ccgctcgagacggcgattccggctgggctgtcagctcccgcagaggtgacgctcgcggcc
gaggcggttgtcggtggcgagacggccgttgcgtccgccgcgaccgaagcggtcgtggcg
gtcgtggcgccaatcttggccgagccggcgaacgacgagcagcaggcagtcgagcccgtt
tcatcagcggccgagcccgacgcggacgcggtcgaagctggggccgatgccgatgccgat
gccgagctggcgccagtggccgagccgctgccgccggagtccgcctacgctctgccggac
tcccccgagccggccttcagcgttgtggctgatcgcgtggaggcgacgctcagcaatctg
ctcgacaatctgcatctgcccgaacaacaccagccgcagctgcagacgctgcgtgcgcgt
atccagcacggactgaactggtacgagctggtgccggtgctggacgacctggcgatgctg
atgattgccttcagtgatcagggccagcgggatttcgaaagctatctgcagacgttgaac
gagcgtctctcggcaatgcaggagaatctgctcgccgcgcaccaaggccacagcgaaggg
cgcgatgcggcgcaggcgctggacgaggagctgcgcgagcaggtgggtggtctgcagcac
agcatgcgtcaggccactgatctgaccagtctgaagaaggtggtggaggcgcgcctggac
gggctgctggatacggtggatacctatcgccagcagcgtagccagcaggagcagaagctc
ggcgagcgtctgcagcaactggtcagtcgggtcggcagtctcgaacaggccgcgcgcggc
ctgcgcggccatctggaagagcagcggcagaaggcgctgcaggacccgctgaccgggcta
cccaaccgtgcggcctggaacgagcgtctggatctcgagtttgcccgctggcagcgctac
ggcggcgacctgctgctggccgtgctggacgtcgatcacttcaagcgggtcaatgacggc
tacggccacctggcgggtgaccgagtgctgaagatcatcggcagtgaattgcgcaagcgc
ctgcgcaagaccgacttcatcgcccgcttcggtggagaggaattcgtcgtgctgctcccc
aacaccccttacgaggcggggcagcagctgatggatgcgctgcgcgattcgatcagcaat
tgtccgtttcacttcaagggcgagcgcatcgtcatcaccctgtccgctggcctaaccgca
ttcggcgaggacgataccaccgagcgtgcattcgagcgggctgacggcgcgctttaccgc
gccaagaacgcgggtcgcaatcgcgtcgagctggcctga

DBGET integrated database retrieval system