KEGG   Pseudomonas stutzeri RCH2: Psest_0188Help
Entry
Psest_0188        CDS       T02391                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
psh  Pseudomonas stutzeri RCH2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
183244..185142
Genome map
AA seq 632 aa AA seqDB search
MSEEAERWKEKYLQLVERQDQLEARWEQRVDLLRRSLVRSSLAVEGADPAVERCLHAMRE
VLREGDLDDGLSQLVPRLEKAVLDSERYRQERAVRLTEALHRLVAQLLALSPPPELRKPI
KRFAKQLDQRAAQLRELPGLLGELSVLQGQVLTLQEDAAPQQGGFLKRLFGGRDSQLAAI
PLETAIPAGLSAPAEVTLAAEAVVGGETAVASAATEAVVAVVAPILAEPANDEQQAVEPV
SSAAEPDADAVEAGADADADAELAPVAEPLPPESAYALPDSPEPAFSVVADRVEATLSNL
LDNLHLPEQHQPQLQTLRARIQHGLNWYELVPVLDDLAMLMIAFSDQGQRDFESYLQTLN
ERLSAMQENLLAAHQGHSEGRDAAQALDEELREQVGGLQHSMRQATDLTSLKKVVEARLD
GLLDTVDTYRQQRSQQEQKLGERLQQLVSRVGSLEQAARGLRGHLEEQRQKALQDPLTGL
PNRAAWNERLDLEFARWQRYGGDLLLAVLDVDHFKRVNDGYGHLAGDRVLKIIGSELRKR
LRKTDFIARFGGEEFVVLLPNTPYEAGQQLMDALRDSISNCPFHFKGERIVITLSAGLTA
FGEDDTTERAFERADGALYRAKNAGRNRVELA
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagaagccgaacgctggaaggaaaagtatcttcagctcgtcgagcgccaggac
cagctggaagcccgctgggaacagcgcgtggatctgctacggcgcagtctggtgcgcagc
agtctggcggtggaaggtgccgaccccgcggtcgagcgctgtctgcatgcgatgcgtgag
gtgctgcgcgagggcgatctggacgatggcctcagccagttggtgccgcgtctggaaaag
gccgtactcgattccgagcggtatcggcaggagcgcgcggtgcggttgaccgaggcactg
catcgcctggtcgcccagctgctggcactctcgcctccgccggaactgcgcaagcctatc
aagcgctttgccaaacagctggaccagcgcgccgctcagctccgcgagctgccggggctg
cttggtgagttgagtgttttgcaaggccaggtgctgacgctgcaggaggatgccgcgccg
cagcagggtggatttctgaagcgcctgttcggtggccgggacagccagttggcggcgatc
ccgctcgagacggcgattccggctgggctgtcagctcccgcagaggtgacgctcgcggcc
gaggcggttgtcggtggcgagacggccgttgcgtccgccgcgaccgaagcggtcgtggcg
gtcgtggcgccaatcttggccgagccggcgaacgacgagcagcaggcagtcgagcccgtt
tcatcagcggccgagcccgacgcggacgcggtcgaagctggggccgatgccgatgccgat
gccgagctggcgccagtggccgagccgctgccgccggagtccgcctacgctctgccggac
tcccccgagccggccttcagcgttgtggctgatcgcgtggaggcgacgctcagcaatctg
ctcgacaatctgcatctgcccgaacaacaccagccgcagctgcagacgctgcgtgcgcgt
atccagcacggactgaactggtacgagctggtgccggtgctggacgacctggcgatgctg
atgattgccttcagtgatcagggccagcgggatttcgaaagctatctgcagacgttgaac
gagcgtctctcggcaatgcaggagaatctgctcgccgcgcaccaaggccacagcgaaggg
cgcgatgcggcgcaggcgctggacgaggagctgcgcgagcaggtgggtggtctgcagcac
agcatgcgtcaggccactgatctgaccagtctgaagaaggtggtggaggcgcgcctggac
gggctgctggatacggtggatacctatcgccagcagcgtagccagcaggagcagaagctc
ggcgagcgtctgcagcaactggtcagtcgggtcggcagtctcgaacaggccgcgcgcggc
ctgcgcggccatctggaagagcagcggcagaaggcgctgcaggacccgctgaccgggcta
cccaaccgtgcggcctggaacgagcgtctggatctcgagtttgcccgctggcagcgctac
ggcggcgacctgctgctggccgtgctggacgtcgatcacttcaagcgggtcaatgacggc
tacggccacctggcgggtgaccgagtgctgaagatcatcggcagtgaattgcgcaagcgc
ctgcgcaagaccgacttcatcgcccgcttcggtggagaggaattcgtcgtgctgctcccc
aacaccccttacgaggcggggcagcagctgatggatgcgctgcgcgattcgatcagcaat
tgtccgtttcacttcaagggcgagcgcatcgtcatcaccctgtccgctggcctaaccgca
ttcggcgaggacgataccaccgagcgtgcattcgagcgggctgacggcgcgctttaccgc
gccaagaacgcgggtcgcaatcgcgtcgagctggcctga

DBGET integrated database retrieval system