KEGG   Pseudomonas stutzeri RCH2: Psest_0214Help
Entry
Psest_0214        CDS       T02391                                 

Definition
DNA helicase/exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:psh03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
220244..222091
Genome map
AA seq 615 aa AA seqDB search
MTLADLPLGPLERAFVASLQRLDPHASEPVLLAAALCCEALADGDVCLPLGRLAGKRPWP
DQDFSLPPLATWRAQLDASELIGAPGDYAPLILSGERLYLARYQAYEQQLAEQLLTRAAD
APDVDEAQLSDSLARLFAFNQQSPDWQRLAAAQAVRRRLAVISGGPGTGKTTTVVRLLAA
LLEQPGGERLAIGLAAPTGKAAARMAEAIRNAKAELPVSDAVKDALPDEARTLHRLLGSR
GDSPRVRHDAANPLALDVLVVDEASMVDLALMAKLVAALPPKARLILLGDKDQLAAVEAG
AVFAELCEGRGFDSQEAADLQRITGQNVPVETPRSRLGDAVVLLTHSHRFAGDSGIGELA
RRINGGDAKGTVALLQEGRPDLAWNAAPSPAALIERLEQGYAPYLQAVRQADPSAAFEAF
NGFRALTAQREGAFGVTGINEALEARFKRRLGVPARERWYPGRAVMVRQNDYALGLFNGD
IGLCLRTEQGLRVFFEGDDGYRGFAPARLPSHDSAFAMTVHKSQGSEFAEVLLALPEQPS
PLLTRSLFYTGITRAKRKVEIWALPARLAEAVNTRAERAAGLAERLALPRVPDRPVEALP
AAKPDEPKGDQLSLF
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgacccttgccgatctgcccctcggcccactggagcgcgccttcgtcgccagcctgcag
cgcctcgacccgcatgcgtccgagccggtgctgctcgccgccgcgctctgttgcgaagcg
ctggccgatggcgacgtctgcttgccgctgggtcggttagccggcaagcggccatggccg
gatcaggatttcagcctgccgccgcttgcgacctggcgagcgcagttggatgcctcagag
ctgatcggtgcgccgggggattacgcgccgctgatcctgagcggagaacggctctacctc
gcccgttaccaggcttacgaacaacaactggctgagcagcttctgactcgcgcggcggac
gcaccggatgttgatgaagctcagctgagcgacagcctggcgcggttgttcgccttcaac
caacagagcccagactggcaacggctggcagcggctcaggcggtacgtcgtcgcttggca
gtaatctccggtggccccggtaccggcaagaccaccacggtggtgcgcctgttggcggcg
ctgctggaacagcccggtggcgaacgtctggccatcggcctcgcggcacctaccggcaaa
gcggcggcgcgcatggccgaagcgatccgcaacgccaaggccgagctgccggtcagcgat
gccgtcaaggacgctctgccggacgaagcgcgcacattgcaccgcctgctcggcagccgc
ggcgacagcccgcgcgtgcgccacgacgcggccaacccgctggcgctggacgtgctggtg
gtggacgaggcgtcgatggtcgacctggcgttgatggccaagctggtcgccgcgctgccg
ccgaaggcgcggctgatcctgctcggcgacaaggaccagctggccgccgtggaagccggc
gcggtgttcgccgagctctgcgaagggcgcggtttcgatagccaagaggccgccgatctg
caacgcattaccgggcagaacgtaccggtcgagacgccgcgctcgcgcctgggcgatgcg
gtggtgctgctcacccacagccatcgcttcgccggcgacagcggcatcggcgaactggcg
cggcgaatcaatggtggcgatgccaagggcaccgtcgcgctgctgcaggaaggccggccg
gatctggcctggaacgcagcacccagccccgcggcgctgatcgaacggctggagcagggc
tacgcaccctacctgcaagccgtacgccaggccgatccatccgccgcgttcgaggccttc
aatggctttcgcgcgctgaccgcccagcgcgaaggcgcctttggcgtcacgggtatcaac
gaggcgctggaagcgcgcttcaagcgtcgcctcggcgtgccggcgcgtgaacgctggtac
cctggccgcgcggtgatggtccggcagaacgactacgccctgggcctgttcaacggcgat
atcggcctgtgtctgaggaccgagcagggcctgcgggtgttcttcgagggcgacgacggc
taccgcggcttcgccccggcgcgactgccgagccatgacagtgccttcgccatgaccgtg
cacaaaagccagggctcggaattcgccgaagtgctgctggcgttgccggagcaacccagc
cctctgctgacgcgctcgctgttctataccggtatcacccgcgccaaacgcaaggtggag
atctgggcactgccggcgcggctggccgaggcagtcaatacccgcgccgagcgcgccgcc
ggcttggccgagcgactggcgcttccccgcgtgccggacaggcctgtcgaggcattgccg
gcggcgaagccagatgagcctaaaggcgatcagctcagcctgttctga

DBGET integrated database retrieval system