KEGG   Pseudomonas stutzeri RCH2: Psest_0229Help
Entry
Psest_0229        CDS       T02391                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:psh00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:psh00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
238670..239248
Genome map
AA seq 192 aa AA seqDB search
MKPTNGWRFGKLRCSAILAAMNQTRLPLAMIAALAQNRVIGLDNRMPWHLPADLKHFKAM
TLGKPIIMGRKTWDSLGRPLPGRLNLVVSRQADLQLDGAETFTDLDAALVRAEQWAREQG
VDELMLIGGAQLYAQALGQAQRLYLTRIDAAPEGDAFFPAFDEAEWQCVESQPHPAEGEA
PAYRFETWQKQR
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgacgaacggctggcgcttcggcaagctgcgctgctctgctattctcgccgcc
atgaatcagacccgccttcccctcgccatgatcgccgccctcgcgcagaaccgcgtgatc
ggcctcgacaatcgcatgccctggcatctgcccgccgatctcaagcatttcaaggccatg
accctcggcaagccgatcatcatgggccgcaagacttgggattcgctcggtcgcccgctg
ccgggccggctcaatctggtggtcagtcggcaggcggatctgcagctcgacggggcggaa
accttcaccgacctggacgccgcgctggtgcgtgccgagcagtgggcgcgtgagcagggc
gtcgacgagctgatgctgattggcggtgcgcagctgtacgcccaggcgctggggcaggcg
cagcggctttacctgacacgaatcgatgcggctcccgaaggcgatgcattctttccggcc
ttcgacgaggctgagtggcagtgcgtcgaaagccagccacatccggccgagggcgaggca
ccagcctaccgcttcgaaacctggcaaaaacagcgctga

DBGET integrated database retrieval system