KEGG   Pseudomonas stutzeri RCH2: Psest_0354Help
Entry
Psest_0354        CDS       T02391                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psest_0354
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Psest_0354
   00630 Glyoxylate and dicarboxylate metabolism
    Psest_0354
Enzymes [BR:psh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Psest_0354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(379042..381222)
Genome map
AA seq 726 aa AA seqDB search
MTERVQVGGLQVAKVLYDFVNNEAIPGTGVDAAAFWAGADSVIHDLAPKNRALLAKRDDL
QAQIDAWHQARAGQAHDAVAYKSFLQEIGYLLPEAEDFQATTENVDEEIARMAGPQLVVP
IMNARFALNAANARWGSLYDALYGTDAISEADGASKGPGYNEIRGNKVIAYARNFLNEAA
PLETGSHVDSTGYRIEGGKLVVSLKDGSTTGLKNPAQLQGFQGEASAPIAVLLKNNGIHF
EIQIDPASPIGQTDAAGVKDILMESALTTIMDCEDSIAAVDADDKTVVYRNWLGLMKGDL
VEELEKGGKRITRAMNPDRVYTKADGNGELTLHGRSLLFIRNVGHLMTNDAILDKEGNEV
PEGIMDGLFTSLIAVHNLNGNTSRKNTRTGSMYIVKPKMHGPEEVAFATELFGRVEDVLG
LPRNTLKVGIMDEERRTTINLKACIKEARERVVFINTGFLDRTGDEIHTSMEAGPMVRKA
AMKAEKWISAYENNNVDVGLACGLQGKAQIGKGMWAMPDLMAAMLEQKVGHPMAGANTAW
VPSPTAATLHAMHYHKIDVQARQVELAKREKASIDDILTIPLAQDTNWSEEEKRNELDNN
SQGILGYMVRWVEQGVGCSKVPDINDIALMEDRATLRISSQHVANWMRHGVVTKDQVVES
LKRMAPVVDRQNQGDPLYRPMAPDFDNSVAFQAALELVLEGTKQPNGYTEPVLHRRRREF
KAKNGL
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcgcgttcaagtcggtggcctgcaggtcgccaaagtcctgtacgacttcgtg
aacaacgaagcgattcccggtaccggcgtcgatgccgccgccttctgggccggcgccgac
agcgtcatccacgacctggcgccgaagaaccgcgcgctgctggccaagcgcgacgacctg
caggcgcagatcgacgcctggcaccaggctcgcgccggtcaggcccacgacgcagtggca
tacaagagcttcctgcaggaaatcggctacctgctgccggaagccgaagacttccaggcc
accaccgagaacgtcgacgaagaaatcgcccgcatggccggcccgcagctggtggtgccg
atcatgaacgcgcgcttcgccctgaacgccgccaacgcccgctggggctcgctgtacgac
gcgctgtacggcaccgacgcgatctccgaagcagacggcgccagcaagggcccgggctac
aacgagatccgcggcaacaaggtcatcgcctacgcgcgcaacttcctcaatgaagccgca
ccgctggaaaccggctcccacgtcgattccaccggctaccgcatcgaaggcggcaagctg
gttgtttcgctgaaagacggcagcaccaccggcctgaagaacccggcccagctgcagggc
ttccagggcgaagccagcgcaccgatcgccgtgctgctgaagaacaacggcattcacttc
gagatccagatcgacccggccagcccgatcggccagaccgacgcggccggcgtgaaggac
atcctgatggaatcggcgctgaccaccatcatggactgcgaagactccatcgctgccgtc
gacgccgacgacaagaccgtcgtctaccgcaactggctcggcctgatgaagggcgacctg
gtcgaggagcttgaaaaaggcggcaagcgcatcacccgcgcgatgaacccggaccgcgtc
tacaccaaggccgacggcaacggcgagctgaccctgcatggccgctcgctgctgttcatc
cgtaacgtcggtcacctgatgaccaacgatgccatcctcgacaaggaaggcaacgaggtg
ccggaaggcatcatggacggcctgttcaccagcctgatcgcagtgcacaacctcaacggc
aacaccagccgcaagaacacccgcaccggctcgatgtacatcgtcaagccgaagatgcac
ggcccggaagaagtggccttcgccaccgagctgttcggtcgcgtcgaggacgtcctcggt
ctgccgcgcaataccctgaaggttggcatcatggacgaggagcgtcgtaccacgatcaac
ctcaaggcctgcatcaaggaagcgcgcgagcgcgtggtgttcatcaacaccggcttcctc
gaccgcaccggcgacgaaatccacacctccatggaagccggcccgatggtgcgcaaggcg
gccatgaaggccgagaagtggatcagcgcctacgagaacaacaacgtcgacgtgggcctg
gcctgcggcctgcagggcaaggcgcagatcggcaagggcatgtgggccatgcctgacctg
atggcggcgatgctcgagcagaaggtcggccaccccatggccggtgccaacaccgcctgg
gtgccgtcgccgactgctgccaccctgcacgccatgcattaccacaagatcgacgtgcag
gcgcgtcaggtcgaactggccaagcgcgagaaggcgtccatcgacgacatcctcaccatc
ccgctggcgcaagacaccaactggagcgaggaagagaagcgcaacgagctggacaacaac
tcgcagggcatcctcggctacatggttcgctgggtcgaacagggcgtcggctgctccaag
gtgccggacatcaacgacatcgcgctgatggaagaccgtgccaccctgcgtatctccagc
cagcacgtggccaactggatgcgccatggcgtggtgaccaaggatcaggtggtcgaaagc
ctcaagcgcatggcgccggtggttgaccgtcagaaccagggcgacccgctgtaccgcccg
atggcgccggacttcgacaacagcgtggccttccaggctgccctggagctggtcctcgaa
ggcaccaagcagcccaacggctacaccgagccggtactgcaccgccgccgtcgtgagttc
aaggccaagaacggcctgtaa

DBGET integrated database retrieval system