KEGG   Pseudomonas stutzeri RCH2: Psest_0653Help
Entry
Psest_0653        CDS       T02391                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:psh00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Psest_0653
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Psest_0653
Enzymes [BR:psh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Psest_0653
Two-component system [BR:psh02022]
 CheA family
  CheA-CheYBV
   Psest_0653
Bacterial motility proteins [BR:psh02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Psest_0653
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(710106..711161)
Genome map
AA seq 351 aa AA seqDB search
MIKVFIVDDSALVRQVLTACLDSHPGIQVIGQAADPLFALEKMQRDWPDVLVLDVEMPRM
DGITFLRKIMAERPTPAIICSTLTEAGAAITLEALAAGAVGVFTKARLGLKESLQQLSSE
LIRQIEQAARSRPRAAVRAQAKPSSPSREPSPAAGLTTTDRVIALGTSTGGTQALELVLR
QLPADSPGIVIVQHMPEKFTAAFAQRLNNLCQIEVREARHLDRVRAGLALVAPGGRHMQL
KRSGAQYFVEVLDGPPVNRHKPSVDVLFRSVARHAGHNALGIIMTGMGDDGARGLLNMRE
AGARTVAQDEASCVVFGMPKEALQIGAAQSTEALENLPRLISDYARATCRN
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaggtcttcatcgtcgacgactccgcgctggtgcgccaggtactgaccgcctgc
ctggacagccacccgggcatccaggtcatcggccaggccgccgacccgctgttcgccctg
gaaaagatgcagcgcgactggccggacgtgctggtgctggacgtggaaatgccacgcatg
gacggcatcacctttctgcgcaagatcatggctgaacgaccgacaccggcgatcatctgc
tcgaccctcaccgaggccggtgcggcgatcaccctggaagcgctggcagccggagcggtc
ggtgtgttcaccaaggcccgcctgggcctcaaggaaagcctgcagcaactctccagcgag
ctgatccggcagatcgaacaggcggcccgcagccgcccgcgcgccgccgtgcgtgcacaa
gcgaagcccagcagcccgtcccgagagccatcgccggcggcggggctgaccaccaccgat
cgagtcatcgcgcttggcacctcgaccggcggcacccaggcactcgagctggtgctgcgc
cagttgccggcagacagcccgggcatcgtcatcgtccagcacatgccggagaaattcacc
gcagccttcgcccagcgtttgaacaacctgtgccagatcgaggtacgcgaggcgcgccac
ctcgatcgcgtgcgcgccgggctggcgctggtcgctcccggcgggcggcacatgcagctc
aagcgcagcggtgcgcagtacttcgtcgaggtgctcgacgggccgccggtcaaccgccac
aaaccctcggtggatgtgctgttccgctcggtagcgcggcatgccgggcacaacgcgctg
ggcatcatcatgaccggcatgggcgacgatggcgcacgcggcctgctgaacatgcgcgag
gccggtgcccgcaccgtggcgcaggacgaagccagctgcgtggtcttcggcatgccgaag
gaggcgctgcagattggcgctgcgcagagcaccgaggccctggaaaacctgcccaggctg
atcagcgactatgcgcgtgcaacctgccgcaactga

DBGET integrated database retrieval system