KEGG   Pseudomonas stutzeri RCH2: Psest_0667Help
Entry
Psest_0667        CDS       T02391                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:psh00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:psh00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:psh02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
726330..727883
Genome map
AA seq 517 aa AA seqDB search
MSAPDQKRRQLLQGIGAGLALPALGVAPAIIAAPRERPQMLDGVQSGDVAGDRALIWSRC
DRPGRLIVEWDTRSRFGNPRRMVSSITDAGQDFTARVDLRGLPADQSIFYRARFEDARSG
MLSEPWFGHLRSAPTRPRDIRFVWGGDTCGQGYGINPDFGGMRIYESMRMRRPDFFLHSG
DVIYADGPIPAEVTAEDGSIWRNLVTEEKSKVAETLNEFRGNYRYNLLDENLRAFNAEVP
QIWQWDDHEVTNNWSPSKQLDDRYQQVRDIDTLVQRARQAYLEYAPMRMARGDTQGRIYR
KVSYGPLLDVFVLDMRSYRGPNTHNLQTEQGADTVFLGREQLRWLKRELRASRATWKVIA
ADMPIGLHVPDGPRWEAIANGHDGEALGRELEIAELLTFIQRARVRNTVWLTADVHYCAA
HYYHPNRAAYQQFEPFWEFVAGPLNAGSFGPNPLDGTFGPEVVFQKAPPTANSSPRAGFQ
FFGEVEIDAQTAALQVSLRDIDGTVVYSQTLEPWQQA
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaccggatcagaaacgccgccaactgctgcagggcatcggcgccggcctcgcc
ctgccggctctgggcgttgcgcccgccattatcgccgcgccgcgcgaacgcccgcagatg
cttgacggtgtgcaatccggtgacgtggcgggcgaccgcgcgctgatctggagccgctgc
gaccgccccggccgcctgatcgtcgagtgggatacgcgcagtcgcttcggcaatccgcgg
cgcatggtttcttcgatcaccgatgccggccaggacttcactgcccgcgtcgacctgcgc
gggctgccggcggatcaatcgatcttctaccgcgcgcgctttgaagatgcccgcagcggc
atgctcagcgagccctggttcggccatctgcgcagcgcaccaacgcgcccgcgcgacatt
cgcttcgtctggggcggtgacacctgtggccagggttacggcatcaacccggacttcggc
ggcatgcgcatctacgaaagcatgcgcatgcgccggccggatttcttcctgcacagcggc
gatgtgatctatgccgacgggccgatccccgccgaggttaccgccgaggacggcagcatc
tggcgcaacctggtcaccgaggaaaagagcaaggttgccgagacgctcaacgagtttcgc
ggcaactaccgctacaacctgctggacgagaacctccgggccttcaacgccgaggtgccg
cagatctggcagtgggacgatcacgaggtgaccaacaactggtcgccgagcaagcaactg
gacgaccgctatcagcaggtgcgcgacatcgataccctggtgcagcgcgcccgccaggcc
tatctcgaatacgcgccgatgcgcatggcccgtggcgacacgcaggggcgcatctatcgc
aaagtcagctacgggccgctgctggatgtgttcgtgctggacatgcgcagctaccgcggg
ccgaacacccataatctgcaaacggagcagggcgcggatacggtatttctcggccgcgag
cagctgcgctggctcaagcgcgagctgcgggcatcgcgcgcgacctggaaggtcatcgcc
gccgacatgcccatcggcctgcacgtaccggacggcccgcgttgggaggcgatcgccaat
ggccatgacggcgaggcgcttggccgcgagctggaaatcgccgagctgctgaccttcatc
cagcgcgcgcgagtgcgcaacactgtctggctgaccgcggatgtgcattactgcgcggcg
cattactaccaccccaatcgcgcggcctatcagcagttcgagccgttctgggaattcgtc
gcaggcccgctgaatgccggcagcttcgggccgaacccgctggacggcaccttcggcccg
gaggtggtgttccagaaggcgccgccaactgcgaacagctcgccgcgggcaggcttccag
ttcttcggcgaggtggagatcgacgcgcagaccgccgcgttgcaggtaagcctgcgcgac
atcgacggcacggtggtctacagccagacgctggagccctggcagcaggcctga

DBGET integrated database retrieval system