KEGG   Pseudomonas stutzeri RCH2: Psest_0793Help
Entry
Psest_0793        CDS       T02391                                 

Definition
nitrous oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:psh00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
867181..869094
Genome map
AA seq 637 aa AA seqDB search
MSDKSKNNPEVLEKGGMSRRGFLGASAVTGAAVAATAFGGAVMSRESWAAAVKNAQQNIH
VAPGELDDYYGFWSGGHQGEVRVMGIPSMRELMRIPVFNVDSATGWGLTNESRAIMGDSA
KFLNGDCHHPHISMTDGKYDGKYLFINDKANTRVARIRLDIMKCDKMLTVPNCQAIHGLR
LQKVPYTKYVFANAEFVIPHPNDGKVFDLQDENSYTMYNAIDAETMEMAFQIIVDGNLDN
TDMDYTGRFTAATCYNSEKAYDLGGMMRNERDWVVVFDIEAAEKAVKAGKFTTLGDSKVP
VLDGRKKGDKDSEFTRYIPVPKNPHGCNTSSDGKYFIANGKLSPTVSMIEIAKLPDLFAG
KLKDPRDTIAAEVELGLGPLHTTFDGRGNAYTTLFIDSQVVKWNMADAVRAYNGEKVNYI
KQKLDVHYQPGHIHASLCETSEADGKWLVALCKFGKDRFLPTGPLHPENDQLIDISGDEM
KLVHDGPTYAEPHDCIMARRDQIKTKKIWDRNDPFFAPTLERAKKDGINLDADNKVIRDG
NKVRVYMTSMAPAFGVQEFTVKQGDEVTVTITNIDQIEDVSHGFVMVNHGVSMEISPQQT
SSITFVADKPGLHWYYCSWFCHALHMEMVGRMLVEPA
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaagagcaagaacaatcccgaggtactggagaagggcggcatgagccgtcgc
ggtttcctcggtgccagcgcggtaactggcgcggccgtcgcggccactgccttcggtggc
gcggtaatgagccgcgagtcctgggctgcagcggtaaagaatgcgcagcagaacatccac
gtcgccccgggcgagctggatgactactacggcttctggagcggcggccaccagggcgaa
gtccgcgtgatgggcatcccgtcgatgcgcgaactgatgcgcatcccggtgttcaacgtc
gactcggcgaccggctggggcctgaccaacgaaagccgcgcgatcatgggcgacagtgcc
aagttcctcaacggcgactgccaccacccgcacatctcgatgaccgacggcaagtacgac
ggcaagtacctgttcatcaacgacaaggccaacacccgcgtcgcacgtatccgcctggat
atcatgaagtgcgacaagatgctgaccgtgcccaactgccaggcgatccacggtctgcgt
ctgcagaaggtgccctataccaagtacgtgttcgccaacgccgaattcgtcatcccgcac
ccgaacgacggcaaggtcttcgatctgcaggatgagaacagctacaccatgtacaacgcc
atcgatgccgaaacgatggagatggccttccagatcatcgtcgatggcaacctcgacaac
accgacatggactacaccggccgcttcaccgcagccacctgctacaactcggagaaggcc
tacgacctcggcggcatgatgcgcaacgagcgcgactgggtcgtggtgttcgacatcgag
gcggcggagaaagcggtcaaggccggcaagttcaccaccctcggcgactccaaggtgccg
gtgctcgatggtcgcaaaaagggcgacaaggacagcgagttcacccgctacatcccggtg
ccgaagaacccgcacggctgcaacacctcgtccgatggcaagtacttcatcgccaacggc
aagctctcgccgaccgtgtcgatgatcgagatcgccaagctgcccgatctgttcgccggc
aagctgaaggacccgcgcgacaccatcgccgccgaagtggaactgggcctcggcccgctg
cacaccaccttcgacggtcgcggcaacgcctacaccacgctgttcatcgacagccaggtg
gtcaagtggaacatggccgacgcggtacgcgcctacaacggcgagaaggtcaactacatc
aagcagaagctggacgtgcactatcagccgggccacatccatgcctcgctgtgcgaaacc
agcgaggccgatggcaaatggctggtggcgctgtgcaagttcggcaaggaccgcttcctg
ccgaccggcccgctgcatccggagaacgatcagctgatcgacatttccggcgacgagatg
aagctggtgcatgacggcccgacctatgccgagccgcacgactgcatcatggcccgccgc
gaccagatcaagaccaagaagatctgggaccgcaacgacccgttcttcgcgccgacgctg
gaacgcgcgaagaaggacggcatcaacctggacgccgacaacaaggtcatccgtgacggc
aacaaggtgcgcgtgtacatgacctccatggcgccggcgttcggtgtgcaggagttcacc
gtcaagcagggcgacgaagtcaccgtgaccatcaccaacatcgaccagatcgaagacgtg
tcccacggcttcgtcatggtcaaccacggtgtgagcatggagatcagcccgcagcagacc
tcttccatcaccttcgtggctgacaagcctggcctgcactggtactactgcagctggttc
tgccatgccctgcacatggaaatggtcggccgcatgctggtcgagcctgcgtaa

DBGET integrated database retrieval system