KEGG   Pseudomonas stutzeri RCH2: Psest_0850Help
Entry
Psest_0850        CDS       T02391                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00010  Glycolysis / Gluconeogenesis
psh00052  Galactose metabolism
psh00500  Starch and sucrose metabolism
psh00520  Amino sugar and nucleotide sugar metabolism
psh00521  Streptomycin biosynthesis
psh01100  Metabolic pathways
psh01110  Biosynthesis of secondary metabolites
psh01120  Microbial metabolism in diverse environments
psh01130  Biosynthesis of antibiotics
psh01200  Carbon metabolism
Module
psh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
psh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psest_0850
   00052 Galactose metabolism
    Psest_0850
   00500 Starch and sucrose metabolism
    Psest_0850
   00520 Amino sugar and nucleotide sugar metabolism
    Psest_0850
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Psest_0850
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Psest_0850
Enzymes [BR:psh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Psest_0850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: AGA85443
UniProt: L0GFB5
Position
920458..921417
Genome map
AA seq 319 aa AA seqDB search
MRLALVGDIGGTNARFALWRDSRLESVRVLAAADFATPEMAVEYYLASLGLAPGSVEAAC
LACAGPVKGEQFTFTNNHWRLTRSDFCGALQMGELLLINDFAAMALGMTRVGEAGRRMIC
AGEAEPDAPALVIGPGTGLGVAGLLPLGGGSWRALPGEGGHVDLPVADAHEAALWQMLFA
QLGHVRAEDVLSGGGLLLLYRTVCTVAGLAPRLASPAEVTAAALAGDHVAVATLEQFCVW
LGRVAGNNVLTLGARGGVYIVGGVVPRFADFFAASGFARGFTSKGCMSRYLGDVPVWLVT
AEFPGLEGAGVALEQALAR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaggctggcgctggtcggcgatatcggcggcaccaatgcgcgcttcgcgctgtggcgc
gactcgcggctggagtcggtacgggttctggcggcggcggatttcgccacgcccgaaatg
gcggttgagtattacctggcatccctcggcctggcgccgggcagcgtcgaggcagcctgt
ctggcctgcgccgggccggtcaaaggcgagcagttcactttcaccaacaatcactggcgg
ctgacgcgaagcgacttctgcggcgccctgcagatgggcgagctgttgctgatcaatgac
ttcgccgcgatggcgctgggtatgacgcgtgtaggcgaagcggggcgccgcatgatctgc
gctggcgaggccgagcccgatgcgccggcactggtcatcgggccgggcaccgggcttggc
gttgccgggttgctacccttggggggtggcagctggcgtgcattgccgggggagggtggg
catgtcgacctgcccgtggcggatgcgcacgaggcggcgctgtggcagatgctgttcgct
cagcttggccatgtgcgcgccgaggacgtgctcagtggcggtggcctgttgctgctctat
cgtacggtctgcaccgtggccggtttggcgccgcgactggcgtcgccggctgaagtcacc
gcggctgcgctggctggcgatcatgtcgcggtggcgaccctggagcagttctgcgtgtgg
ctcggccgggtcgccggcaacaacgtgctcacgctcggcgcgcgcggtggggtgtatatc
gtcggtggtgtggtgccgcgtttcgccgatttcttcgcggccagtggtttcgctcgcggc
tttaccagcaagggctgcatgagtcgctatctcggcgatgtgccggtgtggctggtaact
gctgagtttccagggcttgagggcgccggtgtggcgctggagcaggcgctggcgcgctga

DBGET integrated database retrieval system