KEGG   Pseudomonas stutzeri RCH2: Psest_1109Help
Entry
Psest_1109        CDS       T02391                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00900  Terpenoid backbone biosynthesis
psh01100  Metabolic pathways
psh01110  Biosynthesis of secondary metabolites
psh01130  Biosynthesis of antibiotics
Module
psh_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Psest_1109
Enzymes [BR:psh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Psest_1109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AGA85673
UniProt: L0GG07
Position
complement(1203140..1204000)
Genome map
AA seq 286 aa AA seqDB search
MQTLTLPAPAKLNLMLHITGRRADGYHELQTLFQFLDHGDELSFRLREDGEIRLHTELPG
VDHDSNLIVRAARLLQRTSNCSLGADITLLKRLPMGGGIGGGSSDAATTLLGLDYLWNLH
LGEERLAELGLSLGADVPVFVRGRAAFAEGVGERLQPVDLPEPWFLVIAPQVSVSTAEIF
ADPELTRNTPAITVRSLLAGGGHNDCQPVVEKRYPEVRNALSLLNKFVPASMTGTGACVF
GSFPNEGEADKVRRQLPDTLPSFVARGRNVSMLHRCLEKLAQEVSA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcagacactcaccctgccggcaccggccaagctcaatctgatgctgcacatcaccggc
cgccgcgccgatggctatcacgagttgcagacgctgttccagtttctcgaccatggtgac
gaactcagcttccgcctgcgtgaagacggcgaaatccgtctgcataccgagctccccggc
gtcgatcacgacagcaacctgatcgtccgtgcggcgcgcctgctgcagcgcaccagcaac
tgctcgctcggcgcagacatcaccctgctcaaacgcctgcccatgggtggcggtatcggc
ggcggcagctccgacgcagcgaccaccctgctcggtctcgactacctgtggaatctgcac
ctcggcgaagagcgactcgccgaactggggctcagcctgggcgccgatgtaccggtgttc
gtccgcggccgcgcggcgtttgcggagggggttggcgagcgcctgcaaccggtcgattta
cccgagccatggttcctcgtaatcgcgccgcaagtctctgttagtacagcggaaatattt
gccgacccagagttgacacgtaataccccggccattacagttcgcagccttcttgcaggg
ggcggtcataatgactgtcagccggtcgtcgagaagcgttatccagaagttcgtaacgct
ttgagcttgttgaacaaattcgttcccgcaagcatgactggcactggagcttgtgtgttt
gggagcttcccaaacgaaggcgaggctgataaagtccgccgccaacttccagacactttg
ccaagtttcgtggcccgcggtcgtaacgtttcgatgttgcaccgatgccttgaaaaactg
gcgcaggaagtaagtgcgtag

DBGET integrated database retrieval system