KEGG   Pseudomonas stutzeri RCH2: Psest_1618Help
Entry
Psest_1618        CDS       T02391                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:psh01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:psh00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1721455..1722603)
Genome map
AA seq 382 aa AA seqDB search
MTAPALSPTLELACELINRPSVTPLDEGCQQLMTQRLAACGFAIEPMHIEDVENFWAIRG
SEGPVLCFAGHTDVVPTGPLQAWQNPPFSARIDEQGMLHGRGAADMKGSLAAMVVAVERF
TAAHPDHKGQIAFLITSDEEGPAHHGTKAVVERLRERGQRLDWCIVGEPSSTTLVGDVVK
NGRRGSLGGTLTVRGQQGHVAYPHLAKNPIHLAAPALAELAAEHWDDGNAFFPPTSFQIS
NLNAGTGTTNVIPGTLEAVFNFRFSTESTVEQLKQRTAAILDKHGLDWNVEWALSGLPFL
TEPGALLDGVAKAIRSVTGRETTPSTSGGTSDGRFIATLGTQVVELGPVNATIHQVDEHI
LASDLDLLTDIYYLTLVNLLAC
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccctgccctttccccgaccctcgaactcgcctgcgagctgatcaaccgcccc
tcggtcacaccgctggacgaaggctgccagcagctgatgacccagcgcctggcggcctgc
ggcttcgccatcgagccgatgcacatcgaggacgtggagaatttctgggcgattcgcggc
agcgaaggcccggtactgtgtttcgccggccataccgacgtggtcccgaccggcccgctg
caggcctggcagaacccgccgttcagtgcgcgcatcgacgagcaggggatgctgcacggg
cgcggcgcggcagacatgaaaggcagcctggcagccatggtagtcgcggtggagcgcttc
accgctgctcatccggatcacaaggggcagatcgcctttctcatcaccagcgacgaagaa
ggtccggcgcaccacggcaccaaggccgtggtcgagcgcctgcgcgaacgtggccagcgc
ctggactggtgcatcgtcggcgaaccgtcaagcacgacgctggtaggcgacgtggtgaag
aacggtcgccgcggctcgctgggcggcacactcaccgtgcgcggccagcagggccatgtc
gcctatccgcatctggcgaagaatccgatccacctggctgcgccggcgctggcagaactg
gccgcggagcattgggacgatggtaatgccttcttcccgccgaccagcttccagatctcc
aacctgaacgccggcaccggcacgaccaacgtgattcccggcacgctggaagcagtattc
aacttccgcttctccaccgaatccaccgtcgagcagctcaagcaacgcaccgcggcgatt
ctcgacaagcacggcctggactggaacgtcgagtgggccctgtccggcctgcccttcctc
accgagccgggcgcgctgctcgacggcgtggccaaggcgatccgcagcgttaccggccgt
gagaccacaccatccaccagcggcggcacctcggatggccgctttatcgccaccctcggt
acgcaggtggtcgaactcggcccggtgaatgcgaccatccaccaggtcgacgagcacatc
ctcgccagcgatctcgatctgctcaccgacatctactatctgaccctggtgaacctgctc
gcatgctga

DBGET integrated database retrieval system