KEGG   Pseudomonas stutzeri RCH2: Psest_1859Help
Entry
Psest_1859        CDS       T02391                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Psest_1859
Enzymes [BR:psh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Psest_1859
Transporters [BR:psh02000]
 Other Transporters
  Pores ion channels [TC:1]
   Psest_1859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AGA86405
UniProt: L0GLZ2
Position
complement(1963564..1964235)
Genome map
AA seq 223 aa AA seqDB search
MITVHHLNHSRSHRVLWLMEELELLYELKRYPRDPKTMLAPAELKAVHPLGKSPVITDGE
LTLAESAAILEYLLERYGNGRLAPQSSSAEYRRFRYWMHYAEGSAMPPMLLKLVFDRVAT
GPMPFFIRPVARAIAKGANRAFIGPQLKTHLDYMEAELGKSDWFAGDNFSAADIQMSFPI
EAARARAGLDESRPRLMNFLQRIQQRPAYKRAVERGGPALPAA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgatcacagtccatcacctgaatcactccagatcccatcgcgtcctctggctgatggag
gaactggagctgctttatgagctcaagcgctatccccgcgacccgaagacgatgctcgcc
ccggccgaactcaaagccgttcatccactgggaaaatcgccggtgatcaccgatggcgaa
ctgacgttggccgaatcggcagccattctggaatatctgctggagcgatacggaaatggc
cggctcgcgccgcaaagcagcagcgcggagtaccgcaggttccgctactggatgcactac
gccgaagggtcggcgatgccgccgatgttgctcaagctggtattcgaccgggtcgccacc
gggccgatgcccttctttatccgcccggtggcacgagcgatcgctaagggcgccaatcgg
gccttcatcgggccgcagctaaagactcatctcgattacatggaagcggaactggggaaa
tccgactggttcgctggagataacttcagcgcggcggacatacaaatgagttttccgatc
gaagcggcgcgcgccagagccggactggacgagagccgcccgcggctgatgaatttcctg
cagcgtatacaacagcggcccgcctataaacgagccgtggaacgcggaggacccgccttg
cccgccgcgtag

DBGET integrated database retrieval system