KEGG   Pseudomonas stutzeri RCH2: Psest_1893Help
Entry
Psest_1893        CDS       T02391                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psest_1893
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psest_1893
   00052 Galactose metabolism
    Psest_1893
   00500 Starch and sucrose metabolism
    Psest_1893
   00520 Amino sugar and nucleotide sugar metabolism
    Psest_1893
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Psest_1893
   00524 Butirosin and neomycin biosynthesis
    Psest_1893
Enzymes [BR:psh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Psest_1893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2002586..2003548
Genome map
AA seq 320 aa AA seqDB search
MSTALVGDIGGTNARFALWRDQRIEQIRVLPTADYASPELAIRAYLREVDQPLDALEAVC
LACAGPVGGDLFRFTNNHWQLSREAFCRELGVKELLLINDFTAMALGMTRLHDGERITVC
QGEPEPGRPRLVIGPGTGLGVAGLLPLSGGGWRALPGEGGHICLPIGSEREAAIWAHLHR
SQGHVNAEAVLSGPGLLTLYRACCALDGQQVEFDSPAAITKAALAGDAYATAVLEQFCRW
LGRIVGDNVLTLGARGGVYIVGGVVPRFAEMFLRSGFSEALREKGQMSRYFDRLPVWLVT
APYPGLEGAGVALQPLLEGA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagcgctggttggagatatcggtggtaccaatgcacgttttgccctctggcgt
gatcagcgcatcgagcagattcgagtgctccccaccgcggactacgcgagcccggagctg
gcgattcgcgcctatctgcgtgaagtcgaccagccgctggacgcgctcgaagcggtctgc
ctggcctgtgccgggccggtgggcggcgatctgtttcgcttcaccaacaaccattggcag
ctgagccgcgaagccttctgccgcgagctgggcgtgaaagagctgttgctgatcaacgac
ttcaccgccatggcccttggtatgacgcggttgcacgacggtgagcgcatcacggtttgc
cagggcgagcctgaaccaggacgcccgaggctggtcatagggcccggcaccgggcttggc
gttgcgggattgttgccgttgtcgggcggcggatggcgcgcgttgcccggagagggcggg
catatctgcctgccgatcggcagcgagcgagaagcggcgatctgggcgcatctgcatcgt
tcccagggccatgtgaatgccgaggcagtactcagtggcccgggcctgttgacgctctac
cgcgcctgctgtgcgctggacgggcagcaggtggagttcgattcgcccgccgctatcacc
aaggccgcgctggccggcgatgcctatgcaacggcggtgctggagcagttctgccgctgg
ctggggcgtatcgtcggcgataacgtgctgaccctcggcgcccgtggcggcgtttacatc
gtcggtggcgtggtgccgcgtttcgccgagatgttcctgcgcagcggtttcagcgaggcg
ctgcgcgagaaggggcagatgagccgctatttcgatcgcctgccagtatggctggtgacc
gcgccgtatccgggcctggaaggcgcgggcgtggcattgcaaccgttgttggagggagcc
tag

DBGET integrated database retrieval system