KEGG   Pseudomonas stutzeri RCH2: Psest_1991Help
Entry
Psest_1991        CDS       T02391                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:psh00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2109202..2109804
Genome map
AA seq 200 aa AA seqDB search
MLKVYGDYRSGNCYKIKLMLHLLDQPYEWIPINVLRGESRSEEFLKKNPNGKIPVLELED
GTCLWESNAILNYLAEGSEFLPTDPRLRTQVLQWQFFEQYSHEPFLAVARYIKVYLGMPE
DRREEYEAKQLDGYHALNVMEQQLLRTPYLVGEHYSIADVALYAYTHVAEEGGFKLDGYP
AIRQWLQRVASHPRHVGMYD
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtctatggcgattacaggtcgggtaattgctacaagatcaagctgatgctt
catctgctggaccagccttatgagtggattccgatcaatgtcctgcggggcgaatcccgt
tccgaggagtttctcaagaagaatccgaacggcaagattccggttctggaactggaagat
ggcacctgtctttgggagtcgaatgccatcctgaactatctggccgagggcagtgagttt
ctgccgactgacccgcgcttgcgcacccaggtgctgcagtggcagttctttgagcagtac
agccacgagcccttcctggcagtggcccgttacatcaaggtctacctcggtatgccggag
gaccgacgcgaagagtacgaggccaagcagctggacggctatcacgcactgaacgtgatg
gagcagcaactgctgcgcacgccttacctggtcggggagcattattcgatcgccgacgtt
gcgctatatgcctatacgcatgtcgccgaggaaggcgggtttaaattggacggctatcct
gcgattcgccagtggctgcaacgcgtcgccagccatccgcggcatgtcggtatgtacgat
tga

DBGET integrated database retrieval system