KEGG   Pseudomonas stutzeri RCH2: Psest_2014Help
Entry
Psest_2014        CDS       T02391                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00630  Glyoxylate and dicarboxylate metabolism
psh01100  Metabolic pathways
psh01110  Biosynthesis of secondary metabolites
psh01120  Microbial metabolism in diverse environments
psh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Psest_2014
Enzymes [BR:psh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Psest_2014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AGA86548
UniProt: L0GIJ4
Position
complement(2132881..2134476)
Genome map
AA seq 531 aa AA seqDB search
MSAYQDDIKAVAALKEQYGSSWAAINPESVARMRAQNRFKTGLEIAQYTADIMRKDMAEY
DADSSVYTQSLGCWHGFIGQQKLISIKKHLKTTNKRYLYLSGWMVAALRSEFGPLPDQSM
HEKTAVSDLIEELYTFLRQADSRELDLLFTALDAAREAGDNAKAAEIQNQIDNYETHIVP
IIADIDAGFGNPEATYLLAKRMIEAGACCIQIENQVSDEKQCGHQDGKVTVPHADFLAKI
AAVRYAFLELGIDNGVIVARTDSLGAGLTKQIAVTKEPGDLGDLYNSFLDCEEVSEAALG
NGDVVIKREGKLLRPKRLPSNLFQFRAGTGEARCILDCITSLQNGADLLWIETEKPHVGQ
IAAMVDEIRKTIPNAKLVYNNSPSFNWTLNFRQQVFDAFVAEGKDVSAYDRAKLMSVEYD
ETELAQVADEKIRTFQRDGSAHAGIFHHLITLPTYHTAALSTDNLAKGYFADQGMLAYVK
GVQRQELRQGIACVKHQNMAGSDIGDNHKEYFAGEAALKASGKDNTMNQFH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcatatcaagacgacatcaaggcagttgccgccctgaaagagcaatacggcagc
agctgggccgctatcaaccctgagtccgtcgctcgcatgcgcgcccagaaccgcttcaag
accggtctggaaattgctcagtacaccgccgacatcatgcgcaaggacatggccgagtac
gacgccgactcgtccgtctacacgcagtccctcggctgctggcacggcttcattggtcag
cagaagctgatctccatcaagaagcacctgaagaccaccaacaagcgctacctctacctg
tccggctggatggttgctgccctgcgttccgagttcggcccgctgccggaccagtccatg
cacgagaagaccgccgtttccgacctgatcgaggagctgtacaccttcctgcgtcaggct
gacagccgcgaactggacctgctcttcaccgccctggatgctgctcgtgaagctggcgac
aacgccaaggctgccgagatccagaatcagatcgacaactacgaaacccacatcgtaccg
atcatcgccgacatcgatgctggcttcggtaacccggaagccacctacctgctggccaag
cgcatgatcgaagctggtgcgtgctgcatccagatcgaaaaccaggtatccgacgagaag
cagtgcggccaccaggacggtaaagtgaccgttccgcacgccgacttcctcgccaagatc
gccgccgttcgctacgccttccttgagctgggcatcgacaacggcgtgatcgttgcgcgt
accgactccctgggtgccggcctgaccaagcagatcgctgtgaccaaagagccgggcgac
ctgggcgacctgtacaactccttcctggattgcgaagaagtttccgaagccgctctgggc
aacggcgacgtcgtcatcaagcgcgaaggcaagctgctgcgtccgaagcgtctgccgtcc
aacctgttccagttccgtgctggcaccggtgaagcgcgctgcatactggactgcatcacc
tcgctgcagaacggtgctgacctgctgtggatcgaaaccgagaagccgcacgttggccag
atcgcagccatggtcgacgaaatccgcaagaccatcccgaacgccaagctggtctacaac
aacagcccgtcgttcaactggactctgaacttccgccagcaggtgttcgacgcattcgta
gccgaaggcaaggacgtttctgcttacgaccgcgccaagctgatgagcgtcgagtacgac
gaaaccgaactggcccaggttgcagacgagaagatccgtaccttccagcgtgacggttcg
gctcacgccggcatcttccaccacctgatcaccctgccgacctaccacaccgccgcgctg
tcgaccgacaacctggccaagggctacttcgccgaccagggcatgctggcctacgtgaag
ggcgttcagcgtcaggaactgcgtcagggtatcgcctgcgtcaagcaccagaacatggct
ggttccgacatcggcgacaaccacaaggagtacttcgctggcgaagctgctctgaaggca
agcggtaaagacaacaccatgaaccagttccactaa

DBGET integrated database retrieval system