KEGG   Pseudomonas stutzeri RCH2: Psest_2158Help
Entry
Psest_2158        CDS       T02391                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Psest_2158
Enzymes [BR:psh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Psest_2158
Exosome [BR:psh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Psest_2158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2308884..2311097
Genome map
AA seq 737 aa AA seqDB search
MTDRPVLTMPGETLMPSDTDVDALVRAEHGNPFSILGPHPDGDGVVIRAYLPNALGVEVL
DREQQLLAVMEQGQVPGFFFTRLPHQQPYLLKTRWAGGEQISEDPYSFGPQLGELDMHLF
SEGNHRQIGRVFGSQVLEVDGVQGVRFAVWAPNARRVSVVGSFNGWDGRRHPMRLRFPSG
VWELFIPRLQPGDTYKYEILGPNGIVPLKADPIALATEHPPGTASVVARPLDYQWKDQGW
MQQRTSRQSVNAPMSIYELHAGSWRRDGGDHGRLYDWHELAERLIPYVVDLGFTHIELMP
IMEHPFGGSWGYQLLSQFAPSARYGNAHDFAEFVDACHNAGIGVILDWVPAHFPTDAHGL
GEFDGTALYEYAHPFEGFHQDWDTYIYNLGRTEVHGFMLASALHWLREFHVDALRVDAVA
SMLYRDYSRKDGEWIPNRHGGRENLEAIDFLRHLNDVVATETPGALVIAEESTAFPGVSK
PTSEGGLGFSYKWNMGWMHDSLKYVQEDPINRQYHHDKMTFSMVYAYSEHFVLPISHDEV
VHGKGSLIDKMPGDRWQKFANLRAYLSFMWTHPGKKLLFMGSEFGQWREWNHDRELDWHL
LEEADHRGVQNLVRDLNRLYSQEPALHELDSDPRGFQWLIGDDRANSVFAWLRKSSTGQP
LLVIANFTPVVREAYRIGVPVEARWLEVFNSDAECYGGSNTGNGGGMLAEPIESHGEKVS
LTLTLPPLGLLVLRPQA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcgcccggttctgaccatgccaggggaaaccctgatgcccagcgataccgat
gtagacgccctggtgcgagccgaacatggcaacccgttttccatcctcgggccgcatccg
gatggcgatggcgtggtgatccgcgcctacctgcccaacgccttgggtgtcgaagtgctc
gaccgcgagcagcagttgctggctgtgatggagcaggggcaggtgccaggctttttcttt
acccggctgcctcaccagcaaccctatctgctgaaaacccgctgggccggcggcgagcag
atcagcgaagacccctacagcttcggcccgcagctcggtgagctggacatgcacctgttc
tccgaaggcaaccaccgccagatcggacgagtgttcggttcgcaggtgctggaggtcgac
ggtgtgcagggcgtgcgcttcgccgtatgggcgccgaatgcccgtcgcgtgtcggtggtc
ggcagcttcaacggctgggacggtcgccgtcatccgatgcggctgcgctttccctccggc
gtgtgggagctgttcattccgcgcctgcagccgggcgacacctacaaatacgagattctc
gggccaaacggcatcgtgccgctgaaagccgaccccatcgccctggccaccgaacacccg
ccgggaaccgcttcggttgtcgcgcggccgctggattaccagtggaaagaccagggctgg
atgcagcagcgcacgtcgcgccaatccgtcaacgcaccgatgagcatctatgagctgcac
gccggctcctggcgacgcgacggcggcgaccacggccgcctgtatgactggcacgaactc
gccgagcgcctgatcccctatgtcgtggacctgggcttcacccatatcgagctgatgccg
atcatggagcatccgttcggcggctcctggggttaccagctgctttcgcagttcgcgccc
agcgcgcgctatggcaatgcccatgatttcgccgagttcgtcgacgcctgccataacgcc
ggcattggcgtgatcctcgactgggtgccggcgcattttcccaccgatgcccatggcctg
ggcgaattcgacggcaccgcgctgtatgaatacgcgcacccgttcgagggcttccatcag
gactgggatacctacatctacaacctcggccgtaccgaggtgcacggcttcatgctggcc
tcggcgctgcattggcttcgcgaattccatgtcgacgctttgcgtgtggatgccgtggct
tcgatgctctaccgcgactattcacgcaaggatggcgagtggattcccaaccgccacggc
ggtcgcgagaatctcgaggcgatcgacttcctgcgccatctgaatgatgtggtggccacc
gaaacgccgggcgcgctggtgatcgccgaagagtcaaccgcgttccccggcgtgagcaag
cccaccagcgaaggaggcctcggcttctcgtacaagtggaacatgggctggatgcacgac
tcactgaagtatgttcaggaagacccgatcaaccggcagtaccatcacgacaagatgacc
ttcagcatggtctatgcctattccgagcacttcgtcctgccgatttcccacgacgaagtg
gtccacggcaaaggttcgctgatcgacaagatgccgggtgatcgctggcagaagttcgcc
aacctgcgtgcctacctgtcattcatgtggacgcaccccggcaagaaattgctgttcatg
ggcagcgagttcggccagtggcgtgaatggaaccacgaccgcgagctggactggcacctg
cttgaagaggccgatcaccgtggcgtgcaaaacctggtgcgcgatctgaatcgcctctac
agccaggagccggccctgcacgaactggacagcgatccgcgtggcttccagtggctgatc
ggcgatgaccgcgccaatagcgtgtttgcctggctgcgcaagagttcgaccgggcagccg
ctgctggtgatcgccaacttcacaccggtggtgcgtgaggcctatcggattggcgtgccg
gtcgaggccaggtggctggaggtgttcaacagcgatgccgaatgctacggcgggtccaac
accggcaacggcggcggcatgcttgccgagccgatcgagagccacggcgagaaggtttcc
cttacgctgacgctgccgcctttgggcttgctggtattgcgcccgcaggcgtag

DBGET integrated database retrieval system