KEGG   Pseudomonas stutzeri RCH2: Psest_2170Help
Entry
Psest_2170        CDS       T02391                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Psest_2170
Enzymes [BR:psh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Psest_2170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2324956..2327031)
Genome map
AA seq 691 aa AA seqDB search
MSDEALIRLAEAAGLSIDWIDADNREQRVEPAVLREVLACLGLAAETDADIDASLEILAH
KNNHGGVPPLLTCDQHAALDLSAYFPAASRFELQAEDGGVQQGTLDYQARLPAIDAPGYY
RLTIDKHQLTVAIAPLSCPTVAQIAGADAWGLTAQLYSLRRAGDGGLGDTQALESMVSNA
AAHGADALGISPVHAMFSAHINQYSPYSPSSRLFFNVLHAAPGAILGERPLRQAIETCGL
GEELERLERLDLIDWPAVAQSRQRLLRQLFDDFSKGGNPLQVDFDSFRANGGEALENHCR
FEVLHTHLRNAQGHTQHWSDWPSEYRDPASPAVDAFAREHADEVSYHAFGQWLMARGLER
AQVAARSAGMRIGLISDLAVGADGGGSQAWSRQAELLASLSVGAPPDIMNRDGQNWGISA
FSPWGLQQNGFRAYIEMLRANLAHAGGMRIDHVLGLKRLWVVPAGADPKRGVYLNFPFDD
MLRLLCLEAWRHQAVILGEDLGTIPHGLRDVLAARGILGMRVLLFEQHDGHFQTPAQYPA
QALATSTTHDIPTLTGWWRGHDIDWRIKVGQVPESDRDAQWRAREKERAGLNRALCEYSG
KNPDVLLSAEDAVDAAICFLAHTPAPLVLVPVEDALGLEEQTNMPGIVETHPNWRRRYPG
DSATLLDSPASSRRLASFAQARRNHRGAAHR
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgaagccctgatccgcctggcggaagccgccgggctttccattgactggatc
gatgccgacaaccgtgaacagcgggtcgagccggccgtcctgcgcgaggtactcgcctgc
cttgggctggcggcggaaaccgatgcagatatcgacgccagccttgagatccttgcgcac
aagaacaaccacggcggcgtgcctccgctgctcacctgcgatcagcacgctgcactggac
ctttccgcctactttcccgccgccagtcgctttgagctgcaggcagaagatggcggcgtc
cagcagggcacgctcgattaccaggcgcgtttgccggccatcgacgcccctggctattac
cgcctgacgatcgacaagcatcagctgaccgtggccatcgccccgctgtcctgtcccacc
gtcgcgcagatcgccggtgccgatgcctgggggctgacggcccagctgtacagcttgcga
cgagccggtgacggcggcctgggcgacacccaggcgctggagtcgatggtgagcaacgct
gctgctcatggtgccgatgcgctgggtatcagcccggttcatgccatgttcagcgcgcac
atcaaccagtacagcccctactcgccgtcgagccgactgttcttcaacgtgctgcatgcg
gcacccggggcaatcctcggcgagcggccgctgcgccaggccatcgagacctgcggactc
ggcgaagaactggaacggctcgagcgcctggatctgatcgactggcctgccgtcgcccag
tcgcggcaacgcctgctacgccagctgttcgacgacttcagcaagggcggcaaccccttg
caggtggatttcgacagcttccgtgcgaacggtggcgaggcgctggaaaaccactgccgt
ttcgaagtcctgcacacccatctgcgcaatgcacaaggccatacccagcactggagcgat
tggccaagcgagtatcgcgatccggctagcccagccgtggacgcattcgcccgcgaacac
gccgacgaggtgagctatcacgcttttggtcagtggctcatggcccgcggactggagcgc
gcccaggtcgccgcgcgcagcgccggcatgcgcatcggcctgatttccgacctcgcggtc
ggcgccgatggtggcggcagccaggcctggagccgacaggctgagctgttggcttcgctg
agcgtcggggcgccgccggacatcatgaatcgcgacggccagaactggggcatctccgcg
ttctcgccctggggcctgcaacagaacggctttcgcgcctacatcgaaatgctgcgcgcc
aacctcgcccacgccggcggcatgcgcatcgaccatgtgctgggcctgaagcgtctgtgg
gtcgtccctgccggtgccgacccgaagcgcggcgtgtatctcaactttccgttcgacgac
atgctgcgcctgctctgcctcgaagcctggcgccaccaggcggtgatcctgggcgaggac
ctcggcaccattccccacggcctgcgcgatgtgctcgcggctcgcgggatcctcggcatg
cgggtcctgctgttcgaacagcacgacgggcatttccagacgcctgcgcagtatccggcg
caggcgctggccaccagcaccacccacgacatcccgaccctgacgggttggtggcgaggt
cacgatatcgactggcgcatcaaggtcggtcaggtgcccgaatccgaccgcgacgcccag
tggcgagcacgcgagaaggagcgcgccggcctgaatcgcgctctgtgcgaatacagcggc
aagaatccggatgtgctgttgagcgccgaggacgctgtcgatgccgccatctgcttcctg
gcccataccccggcgccactggtgctggtgccggtggaagatgcactcggtctggaagaa
cagaccaacatgcccggcatcgtcgaaacccatcccaactggcgtcgccgctatcccggc
gacagtgcaacgttgctcgacagcccggccagcagccgtcggctggcgtcctttgcgcag
gcccgtcgtaaccatcgtggagctgcgcatcgatga

DBGET integrated database retrieval system