KEGG   Pseudomonas stutzeri RCH2: Psest_2217Help
Entry
Psest_2217        CDS       T02391                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00010  Glycolysis / Gluconeogenesis
psh00020  Citrate cycle (TCA cycle)
psh00620  Pyruvate metabolism
psh01100  Metabolic pathways
psh01110  Biosynthesis of secondary metabolites
psh01120  Microbial metabolism in diverse environments
psh01130  Biosynthesis of antibiotics
psh01200  Carbon metabolism
Module
psh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psest_2217
   00020 Citrate cycle (TCA cycle)
    Psest_2217
   00620 Pyruvate metabolism
    Psest_2217
Enzymes [BR:psh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Psest_2217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AGA86751
UniProt: L0GL63
Position
complement(2366006..2367154)
Genome map
AA seq 382 aa AA seqDB search
MIVFKLPSLGADMDEGTLLQWKVKPGERIERGEVIAVVDTAKAAVDVECWHSGEVLELLV
EPGSKIPVGTPLARLLEPGEAREAALAQSPAPVPVAVAAEQPPVTAVAPPADTSRARISP
VARRRAAELGIDPATLSGSGPHGSVTLQDVEAAAAKAAPADRNAAMRQAIAAAMSRSKRE
IPHYYLSETVAFGAAARWLQAYNAERIPEERLLVSVLLLKAVALALRDYPQLNGYWRDGA
FQPGEGIHLGTAISLRQGGLIAPALHDVAGQPLPQLMQALGDLVQRARAGSLRSSELSDA
TLTVTQLGEQGVDSVFGVIYPPQVALVGVGRIVERPWVEAGALCVMPSVVLSLAADHRAS
DGHYGARFLAEVRRLLQNPEQL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgattgttttcaaactgccgtcgctgggcgcggacatggacgaaggcacactgctgcag
tggaaggtcaagcccggcgagcgcatcgagcgcggcgaggtgatcgccgtggtggatacc
gccaaggccgcggtagatgtcgagtgctggcacagcggtgaagtgctcgagctgctggtc
gaaccgggcagcaagattccggtcggcacgccgctggccaggctgctggaacccggcgaa
gcccgcgaggccgcgctggcgcaatctcccgcgcctgttcccgttgcggtagccgcagag
caaccgccggtgacagcggtcgcgccgccggccgacaccagccgcgcacgcatctctccg
gtggcacgcaggcgcgctgccgaactgggtatcgacccggcgaccctcagcggcagcggc
ccgcacggcagcgtcaccctgcaggatgtcgaagccgccgccgcgaaggccgcgccagcg
gatcgcaatgccgccatgcgccaggccatcgccgccgccatgagtcgctccaagcgcgag
attccccattactacctgagcgaaacggtcgccttcggcgccgcggcgcgctggttgcag
gcctacaacgctgagcgcattcccgaagagcggctgctggtcagcgtactgctgctcaag
gccgtggcgctggcgttgcgcgactatccgcagctgaacggctactggcgcgacggcgcg
ttccagccgggcgaaggcatccacttgggcaccgccatctcgttgcgccagggcggcctg
atcgcaccggcgctgcacgatgtcgccggtcagccattgccgcagctgatgcaggcgctc
ggcgatctggtccagcgtgcccgtgccggatcgctacgcagttcagagctgagcgacgcc
acgctgacggtcacccaactgggcgagcagggcgtggacagcgtgttcggcgtgatctat
ccgccgcaggtggcgttggtaggagtcgggcgcatcgtcgagcggccctgggtcgaggcc
ggtgcgctctgcgtgatgccgagcgtggtgctaagcctggccgccgatcaccgcgccagc
gacggccattacggcgcacgttttctcgcggaagttcgccgcctgctgcaaaaccccgag
caactctaa

DBGET integrated database retrieval system