KEGG   Pseudomonas stutzeri RCH2: Psest_2336Help
Entry
Psest_2336        CDS       T02391                                 

Definition
lysophospholipase L1-like esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Psest_2336
Enzymes [BR:psh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Psest_2336
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Psest_2336
Lipid biosynthesis proteins [BR:psh01004]
 Fatty acid synthase
  Component type
   Psest_2336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2489083..2489688)
Genome map
AA seq 201 aa AA seqDB search
MRSWLKCGALVLLCWAQGALAGTVLVVGDSISAAFGLETSQGWVHLLQQRLVEEGKERRV
VNASISGDTTAGGLARLDPLLKEHAPEVVILELGGNDGLRGQSPAQLKQNLAEMIDRSRD
AGAEVLLLGMRMPPNLGQRYTRAFADAFDSLAAEKPVAYVPFLLEGVGGVAGMMQADGIH
PTAEAQTQLLETVWPALEPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagttggctgaagtgcggggctctggttctgttgtgttgggctcagggagcgctg
gcaggaaccgtgttggtggtcggcgatagtatcagcgccgctttcggcctggaaaccagc
cagggctgggtgcatctgttgcaacaacgcttggttgaggagggcaaggagcggcgcgtc
gtgaacgcttctataagcggcgacaccacggctggcgggctcgcgcggctcgatccgctg
ctaaaggaacatgcacccgaggtggtgattctcgagctgggaggcaacgatggcctgcgt
gggcagtcgccggcccaattgaaacagaatcttgccgagatgattgatcgcagtcgagac
gctggagccgaggtgctgctgttgggtatgcgtatgccgccaaacctcgggcagcgttac
acccgcgctttcgccgatgcgttcgactcgctcgctgcggagaaacctgtggcttatgtg
ccgttcctgctggagggtgtcggcggcgttgcgggcatgatgcaggctgatggtattcat
ccgactgcagaggcgcagactcagttgctggagaccgtctggccagcgctcgaacccttg
ctttga

DBGET integrated database retrieval system