KEGG   Pseudomonas stutzeri RCH2: Psest_2491Help
Entry
Psest_2491        CDS       T02391                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00020  Citrate cycle (TCA cycle)
psh00640  Propanoate metabolism
psh00660  C5-Branched dibasic acid metabolism
psh01100  Metabolic pathways
psh01110  Biosynthesis of secondary metabolites
psh01120  Microbial metabolism in diverse environments
psh01130  Biosynthesis of antibiotics
psh01200  Carbon metabolism
Module
psh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Psest_2491
   00640 Propanoate metabolism
    Psest_2491
   00660 C5-Branched dibasic acid metabolism
    Psest_2491
Enzymes [BR:psh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Psest_2491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: AGA87013
UniProt: L0GJV7
Position
complement(2664094..2665260)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGYAVDSPKEAAEACDKIGGTQWVVKAQVHAGGRGKAGGV
KLVRSKDEARAFAQQWLDKRLVTYQTDANGQPVSKILVEACTDIDKELYLGAVVDRASRR
IVFMASTEGGVDIEKVAHDTPEKILKATIDPLVGAQPFQARELAFQLGLKGDQVKQFVHI
FVGLAQLFQDYDLALLEVNPLVIKTDGNLHCLDAKINIDSNAIYRQPKLRDMADPSQDDP
RESHAAKWELNYVALDGNIGCMVNGAGLAMGTMDIVNLHGGAPANFLDVGGGATEERVTE
AFKIILSDSNVAAVLVNIFGGIVRCDMIAEGIIGAVREVGVKVPVVVRLEGNNADLGAKM
LSESGLNIIGANSLTDAAIQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgagtaccaaggtaaacaactgttcgctgaatacggtctgcccgtgtct
aaaggctatgcagtcgatagcccgaaggaagcagcggaagcctgcgacaagatcggcggc
acacaatgggtggtcaaagcccaggtgcatgccggtggacgtggcaaggcgggtggcgta
aagctggttcgcagcaaggatgaagcccgggctttcgcccagcagtggctcgacaagcgt
ctggtgacctaccagaccgacgccaatggtcagccggtcagcaagatcctcgtcgaggcg
tgcaccgatatcgacaaggagctctatctgggcgccgtggtcgatcgcgccagccgtcgg
atcgtcttcatggcatcgaccgaaggtggcgtggacatcgagaaagtcgcccacgacacg
cccgagaagatcctcaaggccaccatcgacccgctggtgggtgcgcagccgttccaggcg
cgtgaactggctttccagctgggcctcaagggtgaccaggtcaagcagttcgtgcacatc
ttcgtcggccttgcccagctgttccaggactatgatctggccctgctcgaagtgaacccg
ttggtgatcaagactgacggcaatctgcattgcctggatgccaagatcaacatcgacagc
aacgccatctaccgccagccaaagctgcgcgatatggccgacccgtcccaggacgacccg
cgcgaatcgcacgcggccaagtgggagctcaactacgttgcgctcgatggcaacatcggt
tgcatggtcaatggtgcgggcctggccatgggcaccatggacatcgtcaacctgcacggc
ggtgcgccggccaacttcctcgacgtcggcggcggtgccaccgaggagcgtgtaaccgaa
gcgttcaagatcattctttccgacagcaatgttgccgcggttctggtgaacatcttcggt
ggcatcgtgcgttgcgacatgattgccgagggcatcatcggtgcggtgcgtgaagtaggt
gtaaaggtgccggtagtggtgcggctggaaggcaacaatgccgacctgggcgccaagatg
ctgagtgaaagcggtctgaacatcatcggtgcgaacagcctgaccgatgcggccattcag
gttgtcaaagccgcggagggcaagtaa

DBGET integrated database retrieval system