KEGG   Pseudomonas stutzeri RCH2: Psest_2493Help
Entry
Psest_2493        CDS       T02391                                 

Definition
2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psest_2493
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Psest_2493
  Amino acid metabolism
   00310 Lysine degradation
    Psest_2493
Enzymes [BR:psh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Psest_2493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2666987..2668207)
Genome map
AA seq 406 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKQPGDAVKRDELIVDIETDKVVMEVLAEADGVLTEIV
KNEGDTVLSGELLGKLEAGAAAAAAPAQAAAPAAAAPAAAASAGGEEPILAPAARKLAEE
NGIDPNSIRGTGKDGRVTKEDVVAAVEAKKSAPAAAAKPAAPAAAAPIFAEGDRVEKRVP
MTRLRAKVAERLVEAQSSMAMLTTFNEVNMKPIMELRAKYKDLFEKTHNGVRLGFMSFFV
KAAVEALKRQPGVNASIDGNDIVYHGYQDIGVAVSSDRGLVVPVLRNAEHMSLAEIEGGI
NEFGKKAKAGKLTIEEMTGGTFTISNGGVFGSLLSTPIVNPPQTAILGMHKIQERPMAVN
GQVVILPMMYLALSYDHRLIDGKEAVTFLVTMKDLLEDPARLLLDI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgagatcaaagccccgacattcccggaatcggttgccgacggcaccgttgcc
acctggcacaagcagccgggcgacgcggtcaagcgtgatgagctgatcgtcgacatcgaa
accgacaaggttgttatggaagtgctcgccgaagctgatggcgtgctgaccgagatcgtc
aagaacgaaggcgacaccgtgctgagcggcgagctgctcggtaagctggaagcgggcgcc
gctgccgctgctgctcctgctcaggctgccgccccggccgctgctgctccggcagccgct
gccagcgctggcggcgaagagccgattctggcaccggctgcccgcaagctggccgaagag
aatggcatcgacccgaacagcatccgcggcaccggcaaggacggtcgtgtgaccaaggaa
gacgtcgtcgccgccgtcgaagccaagaagtccgctccggctgccgctgccaagccggct
gctccggctgctgccgcgccgatcttcgctgaaggtgatcgcgtcgagaagcgcgttccg
atgacccgcctgcgcgccaaggtggcagagcgtctggtcgaagcccaatcctccatggcg
atgctgactacgttcaacgaagtcaacatgaagccgatcatggagctgcgtgccaagtac
aaggacctgttcgagaagacccacaacggtgtgcgtctgggcttcatgtccttcttcgta
aaggccgcggtcgaagcactcaagcgtcagccgggcgtcaacgcttccatcgatggcaat
gacatcgtctaccacggttatcaggatatcggcgttgccgtttccagtgatcgtggcctg
gtggttccggtgctgcgcaacgccgagcacatgagcctggccgagatcgaaggtggcatc
aacgagttcggcaagaaggccaaggccggcaagctgaccatcgaagaaatgactggcggt
accttcaccatttccaacggtggtgtgttcggttcgctgctgtccaccccgatcgtcaat
ccgccgcagaccgccattcttggtatgcacaagatccaggaacgtccgatggctgttaac
ggccaagtggtcatcctgccgatgatgtacctggcgctgtcctatgaccatcgcttgatc
gacggcaaggaagcagtaaccttcctggttaccatgaaggacctgctggaagacccggcc
cgtctgctgctggatatctga

DBGET integrated database retrieval system