KEGG   Pseudomonas stutzeri RCH2: Psest_2773Help
Entry
Psest_2773        CDS       T02391                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:psh00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2969454..2970962
Genome map
AA seq 502 aa AA seqDB search
MSDQNKQFIVALDQGTTSSRAIVLDRNANVVTIAQREFAQIYPQPSWVEHDPMEIWATQS
GVFVEALAQAGITNEQVAAIGITNQRETAIVWDKITGRPIYNAIVWQSRQSTPICDQLKR
DGMEEHIRKTTGLVIDPYFSGTKIKWILDHVEGSRERARRGELLFGTVDCWLIWKMTQGK
AHVTDYTNASRTLLFDIHKLDWDPVMLEALDIPREMLPEVRSSSEIYGHAYIGSGQSTGI
PIAGIAGDQQAALFGQMCVELGQAKNTYGTGCFLLMNTGTKAVQSEHGLLTTIACGPRGE
VNYALEGAIFNGGSTVQWLRDELKVLNESLDSEYFATKVPDSNGIYLVPAFTGLGAPYWD
PRARGALFGLTRGVKVDHLIRAALESIAYQTRDVLDAMQQDAGERLRALRVDGGAVANNF
LMQFQADLLGTQVERPQMKETTALGAAYLAGLATGFWSDLDELRSKSSIERVFEPACGSE
QREALYRGWQKAVDRTRNWAED
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatcagaacaagcaattcatcgtcgccctcgaccagggcaccaccagctcccgt
gccatcgtgctggatcgcaacgccaatgtggtaaccatcgcccagcgcgagttcgcgcag
atctacccacagccgagctgggtcgaacatgacccgatggaaatctgggccacccagagc
ggtgtgttcgtcgaagccctggcccaggccggtatcaccaacgagcaggtggcggcgatc
ggcatcaccaaccagcgtgaaacggccatcgtctgggacaagatcaccggccgaccgatc
tacaacgccatcgtctggcagagccgccagagcacgccgatctgtgatcagctcaagcgc
gacggcatggaagagcacatccgcaagaccaccggcctggtgatcgacccctacttctcc
ggcaccaagatcaagtggattctcgaccacgtcgagggcagccgtgagcgcgcccgccgc
ggcgaactgctgttcggcaccgtcgactgctggctgatctggaagatgacccagggcaag
gcccatgtcaccgactacaccaacgcgtcgcgcacgctgctgttcgatatccacaagctg
gactgggacccggtgatgctcgaagcgctggatattccgcgcgagatgctgccggaagtg
cgttcctcctcggagatctacgggcacgcctacatcggctccggccagagcaccggcatt
cccatcgccggcatcgccggcgaccagcaggccgcactgttcggccagatgtgcgtcgag
cttggccaggccaagaatacctacggcactggctgcttcctgctgatgaacaccggcacc
aaggcggtgcaatccgaacacggcctgctcaccaccatcgcctgcggaccgcgtggcgag
gtgaattacgcactggaaggcgccatcttcaatggcggttccaccgtgcaatggctgcgt
gacgagctgaaggtgctcaacgagtcgctggattcggagtacttcgccaccaaggtgcca
gacagcaacggcatctacctggtgccggccttcaccggactcggtgcgccctactgggat
ccccgcgcccgcggcgcactgttcggcctgacccgcggggtgaaggtcgatcacctgatc
cgtgcagcattggaatccatcgcctaccagacccgcgacgtactcgacgccatgcagcag
gacgccggcgagcgcttgcgcgccctgcgcgtggacggcggcgcggtggccaacaacttc
ctcatgcagttccaggccgacctgctcggcacccaggtcgagcggccgcagatgaaggaa
accaccgcgctcggtgcggcctatctggcaggcctggcgactggcttctggagcgatctc
gacgagctgcgcagcaagagcagcatcgagcgcgtgttcgaaccggcgtgcggaagtgaa
cagcgcgaagcgctctatcgcggctggcagaaggccgtcgaccgcacgcgcaactgggcc
gaggactga

DBGET integrated database retrieval system