KEGG   Pseudomonas stutzeri RCH2: Psest_2910Help
Entry
Psest_2910        CDS       T02391                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Psest_2910
Enzymes [BR:psh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Psest_2910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3101539..3103617)
Genome map
AA seq 692 aa AA seqDB search
MSTNLFSGARKALVASIAMAALMGGVTVVTVPYAAASTTVAAASVSTKVNAFTNTDWLNG
IWRTGAGFSIPASAANQAAFKAGASVKLADGQVRTISRQQIVGSNMSIFLEGAKLDGNKV
GAPQMVSTVGTATSAPATSTPTLTAPATVAAHSTSINAFTNTDWLNGVWRKSPGFSIPAN
DANKNAFKVGASVKLADGQVRKVTQVQVAGANMSVYLDGAAVNGSVVGAPNKLSLATTTA
TAPAPTAPAPSVVATSNLNSFTNTDWLNGVYRTSPGFSIQASSANIAAFKAGASVRLADG
QVRKVLRAQQVGSNMSVFLEGAAINGSTVGYPKTVSVISESASSAPSAPSVTTPPTTVTP
APAPSAPDTTNGKPLLVGVNLSGAGFGPSVVPGTHGTNYTYPAESYYKKYADLGMPLVRL
PFLWERIQPKLGTPLNTVELARLKQSLDFAQKHNVKVILDLHNYYRYFGKLIGSNEVPIS
SFAAVWKQIVQEVVSHPAVEGYGLMNEPHSTNGLWPQAALAAAQAIRTVDSKRWIYVAGD
RWSSAFHWPYYNTQLITNPWMRDPKNNLVYEAHMYVDKDFSGNYFDKTEQFDPMIGVNRV
KPFVEWLKQNKLRGYIGEHGVPDFSPSAIVATDNLMTYLRQNCIPSTYWAAGPWWGEYAL
SLDVTSGKHRPQLPVLQKHAKTAHSCTSIGPL
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccaacctgttttccggtgcccgcaaggcactcgtcgcttccatcgccatggct
gccctcatgggcggcgtcaccgttgtaacggttccttacgctgctgcttcgaccactgtc
gcagctgcctccgtctcgacgaaggtcaacgcctttaccaataccgattggctcaatggt
atatggcgcacgggcgccgggttctccattccggccagcgctgccaaccaggccgcattc
aaggcgggtgcttcggtgaagctggctgacggccaggttcgcacgatcagccgtcagcag
atcgtcggcagcaacatgagcatcttcctcgaaggcgccaagctggacggtaacaaggtt
ggtgctccgcagatggtcagtaccgtaggtacagcgacttccgctccggctacttccaca
cctacgctgactgcaccggcaacggtcgctgcgcattccaccagtattaatgcgtttacc
aatactgactggctcaatggggtatggcgcaagtcgcccggtttctccattccagccaat
gacgccaacaagaatgcattcaaggtgggtgcttcggtaaaactggccgatggtcaggtt
cgcaaagttacccaggtgcaagtagcgggcgccaatatgagcgtctatctcgatggcgct
gcggtgaatggaagtgtggtcggtgcaccgaacaagttgtcgctggctactactaccgcg
accgctcctgcgcccactgctccagcgccttcagtggtcgccaccagcaatctgaacagc
ttcacgaacaccgactggctgaacggcgtgtaccgcacttctccgggtttctcgatccag
gccagcagtgccaacatcgcagcgttcaaggcgggtgcttcggtaaggctcgctgatggt
caggtgcgcaaggtcctgcgcgcccagcaggtcggcagcaacatgagcgtgttcctcgaa
ggagctgccatcaacggttccacggttggttatccaaagaccgtttccgtgattagcgag
tcggccagcagcgcgccttccgcgccgtcggtgacaacccctccaaccaccgtgacaccg
gctccggcgccttcagccccggacaccaccaatggcaaaccactgctggtcggcgtcaac
ctctccggtgctggttttggtccctcggtagttccgggcacccatggcaccaactacacc
tatccggccgagtcgtactacaagaagtacgccgacctgggcatgccgctggttcgcctg
ccgttcctctgggagcgcatccagcccaagctgggcactccgctcaacacggtagagctg
gcgcgcctgaagcagtcgctggactttgcccagaagcacaacgtcaaggtgattctggac
ctgcacaactactaccgttacttcggcaagttgatcggctccaatgaggtacccatcagc
tccttcgccgcggtgtggaagcagatcgtgcaggaagtggtcagccatccggcggtcgaa
ggctacggcctgatgaacgagccgcactccaccaacgggctctggcctcaggctgccctg
gctgctgcacaggcaatccgtactgttgactccaagcgctggatctacgtagcgggtgat
cgttggtcgagtgccttccactggccgtactacaacacccagctgatcaccaatccgtgg
atgcgcgatccgaagaacaacctggtgtacgaagcgcacatgtatgtcgacaaggacttc
tcgggtaactacttcgacaagaccgagcagttcgatccgatgattggtgtcaatcgcgtc
aagcccttcgttgaatggctgaagcagaacaagctgcgcggttacatcggtgagcacggc
gtcccagacttctcgccgtcggccatcgtcgccactgacaacctgatgacctacctgcgt
cagaactgcatccccagcacctactgggcagcaggtccctggtggggtgagtacgcactg
tcgctggacgtcaccagtggcaagcaccgcccgcagctgccggtactgcaaaagcacgcc
aagactgcacatagctgcaccagcatcggtccgctgtaa

DBGET integrated database retrieval system