KEGG   Pseudomonas stutzeri RCH2: Psest_3125Help
Entry
Psest_3125        CDS       T02391                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Psest_3125
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Psest_3125
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Psest_3125
Enzymes [BR:psh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Psest_3125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3301457..3302866)
Genome map
AA seq 469 aa AA seqDB search
MRYISTRGQAPALNFEDVLLAGLASDGGLYVPENLPRFTVEEIASWAGLPYHELAFRVMR
PFVAGSIPDADFKQILEETYGVFAHSAIAPLRQLNGNEWVLELFHGPTLAFKDFALQLLG
RLLDYVLAKRGERVVIMGATSGDTGSAAIEGCRRCENVDIFILHPHQRVSEVQRRQMTTI
AGDNIHNIAIEGNFDDCQEMVKASFADQAFLKGTRLVAVNSINWARIMAQIVYYFHAALQ
LGGPARSVAFSVPTGNFGDIFAGYLARNMGLPINQLIVATNRNDILHRFMSGNRYDKDTL
HASLSPSMDIMVSSNFERLLFDLHGRNGKAVAELLDGFRASGKLSVEEDRWTEARKLFDS
LAVDDEQTCATIAQVFKETGEVLDPHTAIGVHAARECRRSLSIPMVTLGTAHPVKFPDAV
EKAGIGQALALPAHLADLFERGERCTVLPNELKAVQAFVGQHGNRGKPL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacatcagcacccgtggccaggcgccggccctgaattttgaagatgttctgctg
gcgggcctggccagcgatggcggcctgtacgtgccggagaatctaccgcgcttcaccgtg
gaggagattgcctcctgggccggcttgccgtatcacgaactggctttccgggtcatgcgc
ccgttcgttgccggcagcattccggatgccgacttcaagcaaatcctggaagagacctac
ggcgttttcgctcacagcgccatcgccccgctgcgccagctgaacggcaacgagtgggtg
ctcgaactgttccacggccccaccttggcattcaaggacttcgccctgcagctgctcggt
cgtctgctcgattacgtgctggccaagcgcggcgagcgcgtggtgatcatgggggcgacc
tctggcgataccggttcggccgccatcgagggctgccgtcgttgcgagaacgtcgacatc
ttcatcctgcacccgcaccagcgggtatcggaagtgcagcggcggcagatgaccaccatt
gccggcgacaacatccacaacatcgccatcgaaggcaacttcgatgattgccaggaaatg
gtcaaggccagcttcgccgaccaggcgttcctcaagggcacccggctggttgcggtcaac
tcgatcaactgggcgcggatcatggcccagatcgtttactacttccacgctgcgctgcag
ctcggcggcccggctcgctcggtggccttctcggtaccgaccggcaatttcggcgatatc
tttgccggttatcttgcgcgcaacatggggctgccgatcaaccagctgatcgttgccacc
aaccgcaacgatatcctgcatcgcttcatgtccggcaatcgctacgacaaggacacgctg
catgcgtcactgtcgccgtcgatggacatcatggtgtcgtccaatttcgaacggctgctg
tttgatctgcatggccgcaatggcaaggctgtagccgaattgctggacggcttccgcgcc
agcggcaaactgtcggtggaagaggatcgctggaccgaagcacgcaagctgttcgattcg
ctggccgtggatgacgagcagacctgtgccaccatcgctcaggtcttcaaggagacgggc
gaggtgctcgacccgcacaccgccatcggcgttcatgctgcgcgcgagtgccgccgtagt
ctgagtattccgatggtgacgctgggtaccgcacatccggtgaagttcccggacgcggtg
gagaaggcgggcatcggccaagcgcttgctctgcctgcccacctggcggacctgttcgag
cgcggcgagcgctgcaccgtgctgccgaacgagctgaaagccgtccaggccttcgttggc
cagcacggcaaccgtggcaagccgctctaa

DBGET integrated database retrieval system