KEGG   Pseudomonas stutzeri RCH2: Psest_3128Help
Entry
Psest_3128        CDS       T02391                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
psh  Pseudomonas stutzeri RCH2
Brite
Enzymes [BR:psh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Psest_3128
Secretion system [BR:psh02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Psest_3128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3304948..3305673)
Genome map
AA seq 241 aa AA seqDB search
MGVIRLFAAAAVGLASTVAMAADPDQAIRQALQKIQPDMPIEAVAESPMPGVYQVQLEGG
RQLYASADGQFIIQGYLYQFQNGQAVNLTEQAQSKSVAKQINAIPASEMVVFAPKAPKTH
ITVFTDTDCGYCQKLHSEVPQLNRLGVEVRYVAFPRQGMGSHGANTLTSVWCAKDRQDAM
NKAKAREDLPAASCETPIAKQYQLGQMIGVQGTPAIVLANGQMIPGYQPAAQLAEVALAA
E
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgattcgtttgttcgctgccgccgccgtcggtctggccagcaccgttgcaatg
gccgccgatccggatcaggcaattcgtcaggccctgcagaaaatccagccggacatgccg
atcgaggccgtcgctgaaagtccgatgccgggcgtttatcaggtccagttggaggggggg
cggcagctgtacgccagtgccgatggtcaattcatcatccagggctatctgtaccagttc
cagaatggtcaggccgtcaacctgaccgagcaggcgcagagcaagtcggttgccaagcag
atcaatgcgatccctgcgagtgaaatggtggtattcgcacccaaggcgccgaagacgcat
atcacggtgttcaccgataccgactgtggttattgccagaagctgcacagcgaagtgccg
cagctcaaccgtctcggtgtggaagtgcgctatgtagcattcccgcggcagggcatgggt
agtcatggggccaatacgctgaccagcgtatggtgcgccaaggaccgccaggatgcgatg
aacaaggccaaggctcgcgaggacctgccggccgccagctgtgagacgccgattgccaag
cagtatcagttgggtcaaatgatcggtgttcagggcactccggccatcgttctcgccaac
ggccaaatgattcccggctatcagccggccgcgcagctcgccgaggtggcgctcgctgcc
gagtga

DBGET integrated database retrieval system