KEGG   Pseudomonas stutzeri RCH2: Psest_3204Help
Entry
Psest_3204        CDS       T02391                                 

Definition
dehydrogenase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:psh00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:psh00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3374755..3375459
Genome map
AA seq 234 aa AA seqDB search
MHQAPILITGASQRIGLHCAERLLEDGFTVIVTYRRERDSIDRLRTLGASTLKADFSDEA
GITGFIAALREQTASLRAIVHNASEWRPDTPGQEAEAFRQLFQVHMLAPYLINLHCADLL
RHGGPADIVHIGDDVTRKGSKKHIAYAASKAGLDNLTLSFAASLAPAIKVNGIAPALIQF
NPDDDEEYRRKALAKSALGIEPGAEVIYQSLRYLLDNPYVTGTTLTVNGGRHLI
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcaccaggctccgattctcatcaccggtgccagccagcggatcggactgcattgcgcc
gaacggctgctggaggacggcttcacggttatcgtcacctaccgccgcgaacgcgacagt
atcgaccgactgcgcacgctcggcgcttccacgctgaaggcggatttcagcgatgaagca
ggtattacgggctttatcgccgcactccgagagcagaccgcaagcctgagagcgatcgtc
cacaacgcatccgaatggcgccccgatactcccggccaggaagccgaggcgtttcgccag
ctgttccaggtgcatatgctcgcgccctacctgatcaatctgcactgcgccgacctgctg
cgccacggcgggccggcggacatcgtgcacatcggcgacgacgtcacccgcaagggcagc
aagaaacatatcgcctatgcggcaagcaaggcggggctggacaacctcacgctgtccttt
gccgccagcctggccccggcgatcaaggtcaacggcattgccccggcgctgatccagttc
aatccggacgacgatgaggaataccggcgcaaggcactggcgaaatctgcgctgggcatc
gaacccggtgccgaggtgatctaccagagcctgcgctacctgctcgacaatccgtatgtc
accggcaccacactgaccgtgaacggcggccgtcatctgatctga

DBGET integrated database retrieval system