KEGG   Pseudomonas stutzeri RCH2: Psest_3298Help
Entry
Psest_3298        CDS       T02391                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00340  Histidine metabolism
psh01100  Metabolic pathways
psh01110  Biosynthesis of secondary metabolites
psh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Psest_3298
Enzymes [BR:psh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Psest_3298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AGA87789
UniProt: L0GR45
Position
complement(3465393..3466703)
Genome map
AA seq 436 aa AA seqDB search
MTAPSAIRRLNAADADFARHLDHLLSWESVSDEGVNERVLEIIKAVRERGDAALVELTQR
FDGLQVASMADLILPRARLEQALERITPAQREALEIAAERVSSYHERQKQDSWTYTEADG
TVLGQKVTPLDRAGLYVPGGKASYPSSVLMNAIPAKVAGVPEVVMVVPTPRGELNELVLA
AACIAGVDRVFTIGGAQAVAALAYGTESVPPVDKIVGPGNIYVATAKRHVFGKVGIDMIA
GPSEILVVCDGQTDPDWIAMDLFSQAEHDEDAQSILVSPDAEFLDRVAESIARLLPTLER
ADIARTSIEGRGALILVADMQQAIEVANRIAPEHLELSVAEPEQWLPQIRHAGAIFMGRY
TAEALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSIINCSAEGASTLGKVASVLARG
ESLTAHARSAEYRIKG
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctccctccgccattcgccgactcaacgctgccgatgccgatttcgctcgtcat
ctggatcatctgctgagctgggaaagcgtttccgacgaaggcgtgaacgagagggtgttg
gagatcatcaaggctgtacgcgagcgcggcgatgcggcgctggtcgaactgacccagcgc
ttcgatgggctgcaggttgcctccatggccgatctgatcctgccgcgcgcgcgcctggag
caggctctggagcgcatcacgccagcgcagcgcgaggccctggagatcgccgccgagcgc
gtgagcagctatcacgagcggcagaagcaggactcctggacctataccgaagccgacggc
acggtacttgggcagaaagtcaccccgctggatcgcgccgggctctacgtgcccggcggc
aaggcgtcctatccgtcgtcggtattgatgaacgccattccggccaaggtcgccggtgtg
cctgaagtcgtcatggtcgtgccgactccacgtggcgaactcaacgagctggtgcttgct
gcagcctgcatcgccggcgtcgatcgggtgttcaccattggcggagcgcaggccgttgct
gctctggcatacggcaccgagagcgtgccgccggtggacaagattgtgggcccggggaac
atctacgtggcgaccgccaagcgtcacgtgttcggcaaggttggtatcgacatgattgcc
ggtccatcggaaatcctggtggtctgcgacggacagaccgaccccgactggattgcgatg
gacctgttttcccaggccgagcatgacgaggacgcccagtccatcctggtcagcccggat
gccgaatttctcgatcgagtcgccgaaagcattgctcgcttgctgcccaccctggagcgt
gccgatatcgcccgtacttctatcgaggggcgtggcgcgctgatcctcgtcgccgatatg
cagcaggcgatcgaagttgccaatcgcatcgcgccggagcatctggagctgtcggtcgct
gagcctgagcagtggctgccgcagattcgtcatgccggggcgatcttcatgggtcgctac
accgcagaggcgctgggcgactactgcgccggaccaaaccacgtactgccaacctcgggc
accgcgcgcttctcctcgccactgggggtgtacgacttccagaagcgttcgtcgatcatc
aattgctcggccgagggagcctcgacgctgggcaaggtggcgtcggtgctggcccgtggt
gaatcgctcactgctcacgcccgcagcgccgagtaccgcatcaagggctga

DBGET integrated database retrieval system