KEGG   Pseudomonas stutzeri RCH2: Psest_3300Help
Entry
Psest_3300        CDS       T02391                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
psh  Pseudomonas stutzeri RCH2
Pathway
psh00520  Amino sugar and nucleotide sugar metabolism
psh00550  Peptidoglycan biosynthesis
psh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psh00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Psest_3300
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Psest_3300
Enzymes [BR:psh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Psest_3300
Peptidoglycan biosynthesis and degradation proteins [BR:psh01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Psest_3300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: AGA87791
UniProt: L0GP46
Position
complement(3467684..3468949)
Genome map
AA seq 421 aa AA seqDB search
MDKLIITGGIRLDGEIRISGAKNSALPILAATLLADTPVTVCNLPHLHDITTMIELFGRM
GVQPVIDEKLSVEVDASSIKTLVAPYELVKTMRASILVLGPMVARFGEAEVALPGGCAIG
SRPVDLHIRGLEAMGAQIDVEGGYIKAKAPAGGLRGAHFFFDTVSVTGTENIMMAAALAN
GRSVLENAAREPEVVDLANFLNAMGAKVSGAGTDTITIDGVKRLGGGRYSVMPDRIETGT
YLVAAAATGGRVRLKDTDATLLEAVLHKLVEAGAHIDTGSDWIELDMKGKRPKAVNVRTA
PYPAFPTDMQAQFIALNAIAEGTGTVIETVFENRFMHVYEMNRMGAQILVEGNTAIVTGV
ERLKGAPVMATDLRASASLVIAGLVAEGDTLIDRIYHIDRGYECIEEKLQLLGAKIRRVP
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggacaaattgatcattaccggcggcattcgcctcgatggcgaaatccgcatttccggt
gcgaagaactccgccctgccgatcctggccgccacgttgctggccgacactccggtcacg
gtgtgcaatctgccgcacctgcacgacatcaccacgatgatcgagctgttcggccgtatg
ggcgtgcagccggtcattgacgagaagctcagcgtcgaggttgatgccagcagcatcaag
acgctggttgctccttatgagctggttaaaaccatgcgtgcctcgattctggtgctcggc
ccgatggtggcgcgtttcggtgaagccgaagtggctctgcccggcggctgcgcgatcggt
tcgcgaccggttgacctgcacatccgtggcctggaagccatgggcgcacagatcgacgtc
gaaggcggctacatcaaggccaaggcgcctgctggtggtctgcgtggtgcgcacttcttc
ttcgacacggtcagcgtgaccggtaccgagaacatcatgatggccgccgcgctggccaac
ggccgcagcgtgctggaaaacgccgcacgcgagcctgaagtggtcgatctcgccaatttc
ctcaatgccatgggcgccaaggtttccggtgccggcactgacaccatcaccatcgatggc
gtcaaacgcctcggcggcgggcgctatagcgtcatgcctgaccgtatcgagaccggcact
tacctcgttgcagccgccgctactggcggtcgggttcgtctgaaggacaccgacgcgacg
ctgctcgaagccgtattgcacaagttggtcgaagcgggtgcacatatcgataccggcagc
gactggatcgagctggacatgaaaggcaagcggcccaaggcagtcaacgttcgcacggca
ccgtacccggcgttcccgaccgacatgcaggcgcagttcattgccctgaacgccattgcc
gaaggcactggtaccgtgatcgagaccgtcttcgagaaccgcttcatgcacgtctatgag
atgaatcgcatgggtgcgcagattctggtggagggcaacacggccatcgtcaccggtgtc
gagcgcctcaagggcgcaccagtcatggcaaccgacctgcgcgcttcggcaagtctggtg
atcgctggcctggtcgccgaaggcgatacgctgatcgatcgcatctaccacatcgaccgt
ggttacgagtgcatcgaagagaagctgcagttgctgggggcgaagattcgccgcgttccc
ggctga

DBGET integrated database retrieval system