KEGG   Pseudomonas stutzeri RCH2: Psest_3397Help
Entry
Psest_3397        CDS       T02391                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
psh  Pseudomonas stutzeri RCH2
Brite
Enzymes [BR:psh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Psest_3397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3566201..3567229
Genome map
AA seq 342 aa AA seqDB search
MRPSLPLLLSSLLFTGTASADELRERANAIFKPIPDKVTEVRGHAVSEDQAMLGHKLWFD
PRLSSSHVISCNTCHNLSIGGSDNVPTSIGHGWQKGPRNSPTVLNAVFNAAQFWDGRAKD
LQEQAKGPVQASVEMNSTPERVVATLKSIPEYAAEFKKAFPKDKEPVSFDNMAYALEAFE
VSLTTPNSPFDRFLKGEDKALDDKQKQGLALFMDAGCSSCHNGVNLGGQGYFPFGVVKKP
GAEVLPTGDKGRFTVTNTASDEYVFRAAPLRNVALTPPYFHSGEVWELEQAVAIMGDSQL
GRQLNKDEVSAITAFLHSVTGEQPQVAYPILPASTATTPKPE
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccgtctcttcccctattgcttagcagcctactatttactggcacagcaagcgcc
gacgagctgcgtgagcgcgccaacgccattttcaagccgattccggacaaggtcaccgaa
gtccgcggccatgccgtcagcgaagatcaggcaatgctcggccacaagctctggttcgac
ccgcgcctgtccagcagccatgtgatcagctgcaacacctgccataacctgagcatcggc
ggcagcgacaatgtgccaacctcgatcgggcatggttggcagaagggtccgcgcaactcg
cccaccgtgctgaacgcggtattcaacgccgcacagttctgggacggccgcgccaaggat
ctgcaggaacaggccaaaggcccggtgcaggccagcgtggaaatgaacagcacgcccgag
cgcgtcgtcgccacgctcaagagcattccggagtacgccgccgagttcaagaaagcgttc
cccaaggacaaggagccggtcagtttcgacaacatggcttatgcactggaagccttcgaa
gtcagcctgacgacacctaactcaccgttcgaccgcttcctcaagggcgaggacaaggcg
ctcgacgacaagcagaaacagggactggccctgttcatggatgccggctgctcttcctgc
cacaacggtgtaaacctcggtggtcagggctacttccccttcggcgtggtcaagaagccg
ggtgctgaagtgttgccaacaggtgacaaggggcgtttcacggtgaccaacacggcgagc
gacgagtatgtcttccgcgccgcgccgttgcgtaacgtcgcgctgactccgccctatttc
cacagcggtgaggtctgggagctcgaacaggcggtcgcgatcatgggcgacagccagctg
ggccgtcagctcaacaaggatgaagtcagcgccattaccgccttcctgcacagcgtgacc
ggcgaacagccgcaagtggcctacccgatcctccctgccagcacagcgaccactccgaag
cctgagtga

DBGET integrated database retrieval system